pPIPRA588 vector (V004088)

LOCUS       40924_34689       10380 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pPIPRA588, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10380)
  AUTHORS   Figueroa-Balderas RE, Chi-Ham CL, Bennett AB.
  TITLE     Enabling Technologies for Plant Transformation
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 10380)
  AUTHORS   Figueroa-Balderas RE, Chi-Ham CL, Bennett AB.
  TITLE     Direct Submission
  JOURNAL   Submitted (14-DEC-2011) Plant Sciences, UC Davis, One shields 
            Avenue, Davis, CA 95616, USA
REFERENCE   3  (bases 1 to 10380)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10380)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (14-DEC-2011) Plant Sciences, UC Davis, One shields Avenue, Davis, 
            CA 95616, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10380
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        26..406
                     /label=MAS promoter
                     /note="mannopine synthase promoter (Velten et al., 1984)"
     CDS             420..1142
                     /codon_start=1
                     /gene="ipt"
                     /product="isopentenyl phosphotransferase"
                     /label=ipt
                     /note="condensation of AMP and isopentenylpyrophosphate to
                     form isopentenyl-AMP, a cytokinin"
                     /protein_id="AFI23680.1"
                     /translation="MDLHLIFGPTCTGKTTTAIALAQQTGLPVLSLDRVQCCPQLSTGS
                     GRPTVEELKGTTRLYLDDRPLVEGIIAAKQAHHRLIEEVYNHEANGGLILEGGSTSLLN
                     CMARNSYWSADFRWHIIRHKLPDQETFMKAAKARVKQMLHPAAGHSIIQELVYLWNEPR
                     LRPILKEIDGYRYAMLFASQNQITADMLLQLDANMEGKLINGIAQEYFIHARQQEQKFP
                     QVNAAAFDGFEGHPFGMY"
     gene            420..1142
                     /gene="ipt"
                     /label=ipt
     terminator      1505..1757
                     /label=MAS terminator
                     /note="mannopine synthase terminator"
     misc_feature    2026..2050
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     regulatory      2168..3111
                     /label=FMV34S
                     /note="FMV34S"
                     /regulatory_class="promoter"
     regulatory      3186..3489
                     /label=Pea E9 3' UTR
                     /note="Pea E9 3' UTR"
                     /regulatory_class="terminator"
     misc_feature    3576..3600
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             5064..5690
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             6122..7192
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      7261..7455
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    7929..8069
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(8255..8843)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(9311..10102)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"