Basic Vector Information
- Vector Name:
- pPIPRA587
- Antibiotic Resistance:
- Kanamycin
- Length:
- 12429 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Figueroa-Balderas RE, Chi-Ham CL, Bennett AB.
- Promoter:
- MAS
pPIPRA587 vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
pPIPRA587 vector Sequence
LOCUS 40924_34684 12429 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pPIPRA587, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12429)
AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Bennett AB.
TITLE Enabling Technologies for Plant Transformation
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 12429)
AUTHORS Figueroa-Balderas RE, Chi-Ham CL, Bennett AB.
TITLE Direct Submission
JOURNAL Submitted (14-DEC-2011) Plant Sciences, UC Davis, One shields
Avenue, Davis, CA 95616, USA
REFERENCE 3 (bases 1 to 12429)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 12429)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(14-DEC-2011) Plant Sciences, UC Davis, One shields Avenue, Davis,
CA 95616, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..12429
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 26..406
/label=MAS promoter
/note="mannopine synthase promoter (Velten et al., 1984)"
CDS 420..1142
/codon_start=1
/gene="ipt"
/product="isopentenyl phosphotransferase"
/label=ipt
/note="condensation of AMP and isopentenylpyrophosphate to
form isopentenyl-AMP, a cytokinin"
/protein_id="AFI23677.1"
/translation="MDLHLIFGPTCTGKTTTAIALAQQTGLPVLSLDRVQCCPQLSTGS
GRPTVEELKGTTRLYLDDRPLVEGIIAAKQAHHRLIEEVYNHEANGGLILEGGSTSLLN
CMARNSYWSADFRWHIIRHKLPDQETFMKAAKARVKQMLHPAAGHSIIQELVYLWNEPR
LRPILKEIDGYRYAMLFASQNQITADMLLQLDANMEGKLINGIAQEYFIHARQQEQKFP
QVNAAAFDGFEGHPFGMY"
gene 420..1142
/gene="ipt"
/label=ipt
terminator 1505..1757
/label=MAS terminator
/note="mannopine synthase terminator"
misc_feature 2026..2050
/label=LB T-DNA repeat
/note="left border repeat from nopaline C58 T-DNA"
regulatory 2137..3080
/label=FMV34S
/note="FMV34S"
/regulatory_class="promoter"
CDS 3099..3887
/label=NeoR/KanR
/note="aminoglycoside phosphotransferase"
regulatory 3897..4173
/label=Mas term 3' UTR
/note="Mas term 3' UTR"
/regulatory_class="terminator"
terminator 3908..4160
/label=MAS terminator
/note="mannopine synthase terminator"
regulatory 4127..5160
/label=FMV34S
/note="FMV34S"
/regulatory_class="promoter"
misc_feature 5172..5226
/label=MCS (polylinker)
/note="MCS (polylinker)"
regulatory 5235..5538
/label=Pea E9 3' UTR
/note="Pea E9 3' UTR"
/regulatory_class="terminator"
misc_feature 5625..5649
/label=RB T-DNA repeat
/note="right border repeat from nopaline C58 T-DNA"
CDS 7113..7739
/label=pVS1 StaA
/note="stability protein from the Pseudomonas plasmid pVS1
(Heeb et al., 2000)"
CDS 8171..9241
/label=pVS1 RepA
/note="replication protein from the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
rep_origin 9310..9504
/label=pVS1 oriV
/note="origin of replication for the Pseudomonas plasmid
pVS1 (Heeb et al., 2000)"
misc_feature 9978..10118
/label=bom
/note="basis of mobility region from pBR322"
rep_origin complement(10304..10892)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(11360..12151)
/label=KanR
/note="aminoglycoside phosphotransferase"
This page is informational only.