pFM45 vector (V006217)

LOCUS       40924_20271        3714 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector pFM45, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3714)
  AUTHORS   Moser F, Horwitz A, Chen J, Lim W, Voigt CA.
  TITLE     Genetic sensor for strong methylating compounds
  JOURNAL   ACS Synth Biol 2 (10), 614-624 (2013)
  PUBMED    24032656
REFERENCE   2  (bases 1 to 3714)
  AUTHORS   Moser F, Horwitz A, Chen J, Lim WA, Voigt CA.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-JUL-2013) Biological Engineering, MIT, 500 Tech 
            Square, Rm 209D, Cambridge, MA 02139, USA
REFERENCE   3  (bases 1 to 3714)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 3714)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth 
            Biol"; date: "2013"; volume: "2"; issue: "10"; pages: "614-624"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (05-JUL-2013) Biological Engineering, MIT, 500 Tech Square, Rm 209D,
            Cambridge, MA 02139, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3714
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(413..957)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     terminator      complement(1447..1490)
                     /label=bacterial terminator
                     /note="putative bacterial transcription terminator"
     misc_feature    1493..1514
                     /label=BioBrick prefix
                     /note="BioBrick prefix for parts that do not start with
                     'ATG'"
     misc_feature    1515..1594
                     /label=pAda
                     /note="pAda"
     misc_feature    1532..1549
                     /label=Ada operator
                     /note="Ada operator"
     misc_feature    1603..1615
                     /label=RBS B0032
                     /note="RBS B0032"
     CDS             1622..2335
                     /codon_start=1
                     /label=yeGFP
                     /note="yeast-enhanced green fluorescent protein"
                     /translation="MRKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLK
                     FICTTGKLPVPWPTLVTTFGYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDG
                     NYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV
                     NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLE
                     FVTAAGITHGMDELYK"
     terminator      2358..2429
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      2445..2472
                     /label=T7Te terminator
                     /note="phage T7 early transcription terminator"
     misc_feature    2479..2499
                     /label=BioBrick suffix
                     /note="universal suffix for all parts"
     terminator      2500..2559
                     /label=his operon terminator
                     /note="This putative transcriptin terminator from the E.
                     coli his operon has a 2-bp deletion introduced during 
                     synthesis. Its efficiency has not been determined."
     CDS             complement(2720..3532)
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"