Basic Vector Information
- Vector Name:
- pFGLAHIL6T
- Antibiotic Resistance:
- Ampicillin
- Length:
- 7338 bp
- Type:
- Fungal expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
pFGLAHIL6T vector Map
pFGLAHIL6T vector Sequence
LOCUS 40924_20011 7338 bp DNA circular SYN 18-DEC-2018
DEFINITION Fungal expression vector pFGLAHIL6T, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7338)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 7338)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 3 (bases 1 to 7338)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7338)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7338
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 379..395
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
regulatory 457..1565
/label=A. niger glaA promoter
/note="A. niger glaA promoter"
/regulatory_class="promoter"
misc_feature 1566..1606
/label=5' UTR of A. niger glaA
/note="5' UTR of A. niger glaA"
exon 1607..1820
/note="mutated exon 1 of A. niger glaA"
intron 1821..1895
/note="intron 1 of A. niger glaA"
exon 1896..2182
/note="exon 2 of A. niger glaA"
intron 2183..2237
/note="intron 2 of A. niger glaA"
exon 2238..2334
/note="exon 3 of A. niger glaA"
intron 2335..2395
/note="intron 3 of A. niger glaA"
exon 2396..3033
/note="exon 4 of A. niger glaA"
intron 3034..3091
/note="intron 4 of A. niger glaA"
exon 3092..3775
/note="exon 5 of A. niger glaA"
CDS 3776..3790
/codon_start=1
/note="unnamed protein product; spMF"
/protein_id="SJL89047.1"
/translation="RMDKR"
CDS 3791..4348
/codon_start=1
/note="unnamed protein product; hIL6"
/protein_id="SJL89048.1"
/translation="APVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETC
NKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQN
RFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMT
THLILRSFKEFLQSSLRALRQM"
terminator 4530..5095
/label=trpC terminator
/note="transcription terminator from the Aspergillus
nidulans trpC gene"
primer_bind complement(5117..5133)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(5141..5157)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(5165..5195)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(5210..5231)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(5519..6107)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(6281..7138)
/label=AmpR
/note="beta-lactamase"
promoter complement(7139..7243)
/label=AmpR promoter
This page is informational only.