pFD666 vector (V006285)

LOCUS       40924_19896        5251 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Shuttle cosmid vector pFD666, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5251)
  AUTHORS   Auerswald EA, Ludwig G, Schaller H.
  TITLE     Structural analysis of Tn5
  JOURNAL   Cold Spring Harb. Symp. Quant. Biol. 45 (Pt 1), 107-113 (1981)
  PUBMED    6271452
REFERENCE   2  (bases 1 to 5251)
  AUTHORS   Beck E, Ludwig G, Auerswald EA, Reiss B, Schaller H.
  TITLE     Nucleotide sequence and exact localization of the neomycin 
            phosphotransferase gene from transposon Tn5
  JOURNAL   Gene 19 (3), 327-336 (1982)
  PUBMED    6295884
REFERENCE   3  (bases 1 to 5251)
  AUTHORS   Norrander J, Kempe T, Messing J.
  TITLE     Construction of improved M13 vectors using 
            oligodeoxynucleotide-directed mutagenesis
  JOURNAL   Gene 26 (1), 101-106 (1983)
  PUBMED    6323249
REFERENCE   4  (bases 1 to 5251)
  AUTHORS   Poustka A, Rackwitz HR, Frischauf AM, Hohn B, Lehrach H.
  TITLE     Selective isolation of cosmid clones by homologous recombination in 
            Escherichia coli
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 81 (13), 4129-4133 (1984)
  PUBMED    6330743
REFERENCE   5  (bases 1 to 5251)
  AUTHORS   Yanisch-Perron C, Vieira J, Messing J.
  TITLE     Improved M13 phage cloning vectors and host strains: nucleotide 
            sequences of the M13mp18 and pUC19 vectors
  JOURNAL   Gene 33 (1), 103-119 (1985)
  PUBMED    2985470
REFERENCE   6  (bases 1 to 5251)
  AUTHORS   Gibson TJ, Rosenthal A, Waterston RH.
  TITLE     Lorist6, a cosmid vector with BamHI, NotI, ScaI and HindIII cloning 
            sites and altered neomycin phosphotransferase gene expression
  JOURNAL   Gene 53 (2-3), 283-286 (1987)
  PUBMED    3038694
REFERENCE   7  (bases 1 to 5251)
  AUTHORS   Gibson TJ, Coulson AR, Sulston JE, Little PF.
  TITLE     Lorist2, a cosmid with transcriptional terminators insulating vector
            genes from interference by promoters within the insert: effect on 
            DNA yield and cloned insert frequency
  JOURNAL   Gene 53 (2-3), 275-281 (1987)
  PUBMED    3301536
REFERENCE   8  (bases 1 to 5251)
  AUTHORS   Denis F, Brzezinski R.
  TITLE     An improved aminoglycoside resistance gene cassette for use in 
            gram-negative bacteria and Streptomyces
  JOURNAL   FEMS Microbiol. Lett. 65 (3), 261-264 (1991)
  PUBMED    1655560
REFERENCE   9  (bases 1 to 5251)
  AUTHORS   Denis F, Brzezinski R.
  TITLE     A versatile shuttle cosmid vector for use in Escherichia coli and 
            actinomycetes
  JOURNAL   Gene 111 (1), 115-118 (1992)
  PUBMED    1547947
REFERENCE   10  (bases 1 to 5251)
  AUTHORS   Servin-Gonzalez L, Sampieri AI, Cabello J, Galvan L, Juarez V, 
            Castro C.
  TITLE     Sequence and functional analysis of the Streptomyces 
            phaeochromogenes plasmid pJV1 reveals a modular organization of 
            Streptomyces plasmids that replicate by rolling circle
  JOURNAL   Microbiology 141 (Pt 10), 2499-2510 (1995)
  PUBMED    7582009
REFERENCE   11  (bases 1 to 5251)
  AUTHORS   Denis F, Brzezinski R.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-APR-1997) Immunology, IRCM, 110 Pine Avenue West, 
            Montreal, QC H2W 1R7, Canada
REFERENCE   12  (bases 1 to 5251)
  TITLE     Direct Submission
REFERENCE   13  (bases 1 to 5251)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Cold Spring
            Harb. Symp. Quant. Biol. 45 (Pt 1), 107-113 (1981)"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Gene"; 
            date: "1982"; volume: "19"; issue: "3"; pages: "327-336"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Gene"; 
            date: "1983"; volume: "26"; issue: "1"; pages: "101-106"
COMMENT     SGRef: number: 4; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "1984"; volume: "81"; issue: "13"; pages: 
            "4129-4133"
COMMENT     SGRef: number: 5; type: "Journal Article"; journalName: "Gene"; 
            date: "1985"; volume: "33"; issue: "1"; pages: "103-119"
COMMENT     SGRef: number: 6; type: "Journal Article"; journalName: "Gene 53 
            (2-3), 283-286 (1987)"
COMMENT     SGRef: number: 7; type: "Journal Article"; journalName: "Gene 53 
            (2-3), 275-281 (1987)"
COMMENT     SGRef: number: 8; type: "Journal Article"; journalName: "FEMS 
            Microbiol. Lett."; date: "1991"; volume: "65"; issue: "3"; pages: 
            "261-264"
COMMENT     SGRef: number: 9; type: "Journal Article"; journalName: "Gene"; 
            date: "1992"; volume: "111"; issue: "1"; pages: "115-118"
COMMENT     SGRef: number: 10; type: "Journal Article"; journalName: 
            "Microbiology 141 (Pt 10), 2499-2510 (1995)"
COMMENT     SGRef: number: 11; type: "Journal Article"; journalName: "Submitted 
            (20-APR-1997) Immunology, IRCM, 110 Pine Avenue West, Montreal, QC 
            H2W 1R7, Canada"
COMMENT     SGRef: number: 12; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5251
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..76
                     /label=polylinker
                     /note="polylinker"
     promoter        complement(85..103)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      128..151
                     /label=trpA transcription terminator
                     /note="trpA transcription terminator"
                     /regulatory_class="terminator"
     CDS             complement(188..979)
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     regulatory      complement(1022..1069)
                     /label=synthetic promoter
                     /note="synthetic promoter"
                     /regulatory_class="promoter"
     rep_origin      complement(1261..1849)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    1936..2157
                     /label=bacteriophage lambda COS site
                     /note="bacteriophage lambda COS site"
     rep_origin      2165..2593
                     /direction=RIGHT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     rep_origin      2604..3251
                     /label=pJV1 replication origin
                     /note="pJV1 replication origin"
     CDS             3252..4838
                     /codon_start=1
                     /gene="pJV1 rep"
                     /product="pJV1 rep replication factor"
                     /label=pJV1 rep
                     /protein_id="AAB60866.1"
                     /translation="MLNRVSGIDACGGCGRRVLDPDTGVIYAKSSRGYVVTIGLVRCGR
                     IWFCPECSSAIRRGRTEEIKTGALRHLAAGGTLAVVVLTARHNQTTDLDSLVAALWGGP
                     LLDDKGAPVLDRSGKPRRAPGAYQRMLTAPAFYGRPEARRTRKDGTQYVRPAEDGIRHR
                     IGYIGMVRAAEVTRSKKNGYHPHLNLLVFLGGELSGTPAKGDVVGHFEPSETDLGDWED
                     WLREMWAGALKRADPKFEPSTDCDTPGCKCKGKGHGVMVSIVRSADDVALIEYLTKNQD
                     GKRERPDSVDQDLEAAGAAAMETARLDSKTGRGRKSMTPFQILYRLWDIEVAGLDPDMA
                     EGYGTPKQLRAWWAQYEEALAGRRAIEWTRGLRRHVDLDGDDDEETDLQYVYEPEAAPL
                     DGGVVLTSDAMRLVVGADAELDLDDVVRAEAYYSAVDVVTGLGGRADHVRVATAEELAE
                     VQEVLFARTQERAEESRRQRRIAEHEAEQAAAHRKRQELARCLGLLVRQRGGTQDDSAA
                     DNFVAHIHANR"
     gene            3252..4838
                     /gene="pJV1 rep"
                     /label=pJV1 rep
     terminator      4950..4993
                     /label=bacterial terminator
                     /note="putative bacterial transcription terminator"
     regulatory      complement(4955..4994)
                     /label=rrnC transcription terminator
                     /note="rrnC transcription terminator"
                     /regulatory_class="terminator"
     promoter        5216..5234
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"