Basic Vector Information
- Vector Name:
- pET-RA
- Length:
- 6819 bp
- Type:
- Acinetobacter baumannii cloning vector
- Replication origin:
- ori
- Source/Author:
- Aranda J, Poza M, Gomez B, Rumbo S, Rumbo C, Parreira JR, Rodriguez P, Bou G.
pET-RA vector Map
pET-RA vector Sequence
LOCUS 40924_18226 6819 bp DNA circular SYN 18-DEC-2018
DEFINITION Acinetobacter baumannii cloning vector pET-RA, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6819)
AUTHORS Aranda J, Poza M, Gomez B, Rumbo S, Rumbo C, Parreira JR, Rodriguez
P, Bou G.
TITLE A rapid and simple method for constructing stable mutants of
Acinetobacter baumannii
JOURNAL BMC Microbiol. 10 (1), 279 (2010)
PUBMED 21062436
REFERENCE 2 (bases 1 to 6819)
AUTHORS Poza M, Aranda J, Bou G.
TITLE pET-RA cloning vector for Acinetobacter baumannii
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 6819)
AUTHORS Poza M, Aranda J, Bou G.
TITLE Direct Submission
JOURNAL Submitted (11-MAY-2010) Microbiology, University Hospital A Coruna,
Spain, As Xubias, A Coruna, A Coruna 15006, Spain
REFERENCE 4 (bases 1 to 6819)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 6819)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "BMC
Microbiol."; date: "2010"; volume: "10"; issue: "1"; pages: "279"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(11-MAY-2010) Microbiology, University Hospital A Coruna, Spain, As
Xubias, A Coruna, A Coruna 15006, Spain"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6819
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 52..765
/label=yeGFP
/note="yeast-enhanced green fluorescent protein"
rep_origin 860..2197
terminator 2406..2492
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 2584..2611
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 2630..2721
/label=AmpR promoter
promoter 2732..2836
/label=AmpR promoter
CDS 3137..3628
/codon_start=1
/gene="arr-2"
/product="rifampin ADP-ribosylating transferase ARR-2"
/label=arr-2
/note="confers rifampin resistance"
/protein_id="ADH43300.1"
/translation="MLCSQIPTIKGLKMVKDWIPISHDNYKQVQGPFYHGTKANLAIGD
LLTTGFISHFEDGRILKHIYFSALMEPAVWGAELAMSLSGLEGRGYIYIVEPTGPFEDD
PNLTNKKFPGNPTQSYRTCEPLRIVGVVEDWEGHPVELIRGMLDSLEDLKRRGLHVIED
"
rep_origin 3847..4435
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_feature complement(4621..4761)
/label=bom
/note="basis of mobility region from pBR322"
CDS complement(4866..5054)
/label=rop
/note="Rop protein, which maintains plasmids at low copy
number"
This page is informational only.