pEnEOmCherryF3SG vector (V007560)

LOCUS       40924_17429        4729 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pEnEOmCherryF3SG, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4729)
  AUTHORS   Koiwa H.
  TITLE     Arabidopsis thaliana CPL4 is an essential CTD-phosphatase
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4729)
  AUTHORS   Koiwa H.
  TITLE     Direct Submission
  JOURNAL   Submitted (13-AUG-2013) Department of Horticultural Science, Texas A
REFERENCE   3  (bases 1 to 4729)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4729)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (13-AUG-2013) Department of Horticultural Science, Texas A"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4729
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(63..651)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(744..1550)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     protein_bind    1673..1772
                     /label=attL2
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        1882..2551
                     /label=CaMV 35S promoter (enhanced)
                     /note="cauliflower mosaic virus 35S promoter with a
                     duplicated enhancer region"
     regulatory      2555..2625
                     /label=derived from Tobacco Mosaic Virus
                     /note="derived from Tobacco Mosaic Virus"
                     /regulatory_class="other"
     CDS             2646..3353
                     /label=mCherry
                     /note="monomeric derivative of DsRed fluorescent protein
                     (Shaner et al., 2004)"
     misc_feature    3360..3422
                     /label=3xFLAG tag
                     /note="3xFLAG tag"
     CDS             3423..3536
                     /codon_start=1
                     /product="streptavidin-binding peptide"
                     /label=SBP
                     /note="selected from a peptide library; binds streptavidin
                     with nanomolar affinity (Keefe et al., 2001)"
                     /translation="MDEKTTGWRGGHVVEGLAGELEQLRARLEHHPQGQREP"
     CDS             3543..3563
                     /label=TEV site
                     /note="tobacco etch virus (TEV) protease recognition and 
                     cleavage site"
     CDS             3570..3590
                     /label=TEV site
                     /note="tobacco etch virus (TEV) protease recognition and 
                     cleavage site"
     terminator      4000..4252
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     protein_bind    complement(4273..4372)
                     /label=attL1
                     /note="recombination site for the Gateway(R) LR reaction"
     terminator      complement(4422..4449)
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(4541..4627)
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"