pELR-1 vector (V007579)

Basic Vector Information

Vector Name:
pELR-1
Antibiotic Resistance:
Ampicillin
Length:
9936 bp
Type:
MoClo end-linker vector
Replication origin:
oriV
Source/Author:
Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S.

pELR-1 vector Vector Map

pELR-19936 bp4008001200160020002400280032003600400044004800520056006000640068007200760080008400880092009600Geranylgeranyl diphosphate synthasecrtWLycopene beta-cyclasePhytoene desaturase (lycopene-forming)15-cis-phytoene synthasefusion site; other siteRB T-DNA repeattrfAoriAmpRAmpR promoteroriVLB T-DNA repeatfusion site; other site

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

pELR-1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       V007579                 9936 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V007579
VERSION     V007579
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 9936)
  AUTHORS   Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S.
  TITLE     A modular cloning system for standardized assembly of multigene
            constructs
  JOURNAL   PLoS ONE 6 (2), E16765 (2011)
   PUBMED   21364738
REFERENCE   2  (bases 1 to 9936)
  AUTHORS   Weber E, Engler C, Gruetzner R, Werner S, Marillonnet S.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2010) Icon Genetics GmbH, Weinbergweg 22,
            Halle/Saale 06120, Germany
REFERENCE   3  (bases 1 to 9936)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 9936)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "PLoS ONE";
            date: "2011"; volume: "6"; issue: "2"; pages: "E16765"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (20-DEC-2010) Icon Genetics GmbH, Weinbergweg 22, Halle/Saale 06120,
            Germany"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9936
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             228..1133
                     /gene="crtE"
                     /label="Geranylgeranyl diphosphate synthase"
                     /note="Geranylgeranyl diphosphate synthase from Pantoea
                     ananas. Accession#: P21684"
     CDS             1146..1874
                     /codon_start=1
                     /gene="crtW"
                     /product="beta-carotene ketolase"
                     /label="crtW"
                     /protein_id="ADZ30896.1"
                     /translation="MSAHALPKADLTATSLIVSGGIIAAWLALHVHALWFLDAAAHPIL
                     AIANFLGLTWLSVGLFIIAHDAMHGSVVPGRPRANAAMGQLVLWLYAGFSWRKMIVKHM
                     AHHRHAGTDDDPDFDHGGPVRWYARFIGTYFGWREGLLLPVIVTVYALILGDRWMYVVF
                     WPLPSILASIQLFVFGTWLPHRPGHDAFPDRHNARSSRISDPVSLLTCFHFGGYHHEHH
                     LHPTVPWWRLPSTRTKGDTA"
     gene            1146..1874
                     /gene="crtW"
                     /label="crtW"
     regulatory      1502..1511
                     /note="vertebrate consensus sequence for strong initiation
                     of translation (Kozak, 1987)"
                     /regulatory_class="other"
     CDS             1896..3041
                     /gene="crtY"
                     /label="Lycopene beta-cyclase"
                     /note="Lycopene beta-cyclase from Pantoea ananas.
                     Accession#: P21687"
     CDS             3056..4531
                     /gene="crtI"
                     /label="Phytoene desaturase (lycopene-forming)"
                     /note="Phytoene desaturase (lycopene-forming) from Pantoea
                     ananas. Accession#: P21685"
     CDS             4531..5457
                     /gene="crtB"
                     /label="15-cis-phytoene synthase"
                     /note="15-cis-phytoene synthase from Pantoea ananas.
                     Accession#: P21683"
     misc_feature    5577..5580
                     /note="fusion site; other site"
     misc_feature    5615..5639
                     /label="RB T-DNA repeat"
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             complement(5798..6943)
                     /label="trfA"
                     /note="trans-acting replication protein that binds to and
                     activates oriV"
     rep_origin      complement(7279..7867)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(8041..8898)
                     /label="AmpR"
                     /note="beta-lactamase"
     promoter        complement(8899..9003)
                     /label="AmpR promoter"
     rep_origin      complement(9020..9729)
                     /direction=LEFT
                     /label="oriV"
                     /note="incP origin of replication"
     misc_feature    9813..9837
                     /label="LB T-DNA repeat"
                     /note="left border repeat from nopaline C58 T-DNA"
     misc_feature    9926..9929
                     /note="fusion site; other site"

This page is informational only.