pLTR-RD114A vector (Cat. No.: V007112)

pLTR-RD114A6258 bp30060090012001500180021002400270030003300360039004200450048005100540057006000HIV-1 3' LTRRD114 EnvENV from the MLV 4070ASV40 poly(A) signalf1 oriAmpR promoterSV40 promoterNeoR/KanRTK-pA-RHSV TK poly(A) signalori
Basic Information

Note: pLTR-RD114A is a plasmid encoding the RD114 envelope glycoprotein, utilised for lentiviral vector pseudotyping. It facilitates transduction via the ASCT2 receptor for use in gene therapy research.

Name:
pLTR-RD114A
Antibiotic Resistance:
Kanamycin
Length:
6258 bp
Type:
Mammalian Expression, Lentiviral
Replication origin:
ori
Selection Marker:
Neomycin (select with G418)
Copy Number:
High Copy
Promoter:
SV40
Cloning Method:
Restriction Enzyme
Growth Strain(s):
DH10B
Growth Temperature:
37℃
$ 199.4
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Colamartino ABL, Lemieux W, Bifsha P, Nicoletti S, Chakravarti N, Sanz J, Roméro H, Selleri S, Béland K, Guiot M, Tremblay-Laganière C, Dicaire R, Barreiro L, Lee DA, Verhoeyen E, Haddad E. Efficient and Robust NK-Cell Transduction With Baboon Envelope Pseudotyped Lentivector. Front Immunol. 2019 Dec 16;10:2873. doi: 10.3389/fimmu.2019.02873. PMID: 31921138; PMCID: PMC6927467.

pLTR-RD114A vector (Cat. No.: V007112) Sequence

LOCUS       Exported                6258 bp DNA     circular SYN 06-AUG-2025
DEFINITION  synthetic circular DNA.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6258)
  AUTHORS   Zhang XY, La Russa VF, Reiser J
  TITLE     Transduction of bone-marrow-derived mesenchymal stem cells by using 
            lentivirus vectors pseudotyped with modified RD114 envelope 
            glycoproteins.
  JOURNAL   J Virol. 2004 Feb . 78(3):1219-29.
  PUBMED    14722277
REFERENCE   2  (bases 1 to 6258)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 6258)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6258)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J Virol. 
            2004 Feb . 78(3):1219-29."
COMMENT     SGRef: number: 2; type: "Journal Article"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6258
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     source          join(28..6258,1..27)
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     LTR             209..743
                     /label=HIV-1 3' LTR
     CDS             1220..2812
                     /codon_start=1
                     /label=RD114 Env
                     /translation="MKLPTGMVILCSLIIVRAGFDDPRKAIALVQKQHGKPCECSGGQV
                     SEAPPNSIQQVTCPGKTAYLMTNQKWKCRVTPKNLTPSGGELQNCPCNTFQDSMHSSCY
                     TEYRQCRANNKTYYTATLLKIRSGSLNEVQILQNPNQLLQSPCRGSINQPVCWSATAPI
                     HISDGGGPLDTKRVWTVQKRLEQIHKAMHPELQYHPLALPKVRDDLSLDARTFDILNTT
                     FRLLQMSNFSLAQDCWLCLKLGTPTPLAIPTPSLTYSLADSLANASCQIIPPLLVQPMQ
                     FSNSSCLSSPFINDTEQIDLGAVTFTNCTSVANVSSPLCALNGSVFLCGNNMAYTYLPQ
                     NWTGLCVQASLLPDIDIIPGDEPVPIPAIDHYIHRPKRAVQFIPLLAGLGITAAFTTGA
                     TGLGVSVTQYTKLSHQLISDVQVLSGTIQDLQDQVDSLAEVVLQNRRGLDLLTAEQGGI
                     CLALQEKCCFYANKSGIVRNKIRTLQEELQKRRESLASNPLWTGLQGFLPYLLPLLGPL
                     LTLLLILTIGPCVF"
     CDS             2813..2914
                     /codon_start=1
                     /label=ENV from the MLV 4070A
                     /note="cytoplasmic tail domain derived from the MLV 4070A"
                     /translation="NRLVQFVKDRISVVQALVLTQQYHQLKPIEYEP"
     polyA_signal    3044..3165
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(3172..3627)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        3654..3758
                     /label=AmpR promoter
     promoter        3760..4117
                     /label=SV40 promoter
                     /note="SV40 enhancer and early promoter"
     CDS             4152..4943
                     /codon_start=1
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     primer_bind     complement(5134..5153)
                     /label=TK-pA-R
                     /note="Thymidine kinase polyA, reverse primer"
     polyA_signal    5178..5225
                     /label=HSV TK poly(A) signal
                     /note="herpes simplex virus thymidine kinase
                     polyadenylation signal (Cole and Stacy, 1985)"
     rep_origin      5554..6142
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"