Basic Vector Information
- Vector Name:
- pCotG-NL
- Antibiotic Resistance:
- Ampicillin
- Length:
- 6340 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Iwanicki A, Hinc K, Stasilojc M, Piatek I, Grela A, Lega T, Obuchowski M.
pCotG-NL vector Map
pCotG-NL vector Sequence
LOCUS V008274 6340 bp DNA circular SYN 17-DEC-2018
DEFINITION Exported.
ACCESSION V008274
VERSION V008274
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 6340)
AUTHORS Iwanicki A, Hinc K, Stasilojc M, Piatek I, Grela A, Lega T,
Obuchowski M.
TITLE Vector system for spore sufrace display
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 6340)
AUTHORS Iwanicki A, Hinc K, Stasilojc M, Piatek I, Grela A, Lega T,
Obuchowski M.
TITLE Direct Submission
JOURNAL Submitted (24-OCT-2013) Laboratory of Molecular Bacteriology,
Medical University of Gdansk, Debinki 1, Gdansk 80-211, Poland
REFERENCE 3 (bases 1 to 6340)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 6340)
AUTHORS .
TITLE Direct Submission
COMMENT ##Assembly-Data-START##
Assembly Method :: Vector NTI Advanced v. 10
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(24-OCT-2013) Laboratory of Molecular Bacteriology, Medical
University of Gdansk, Debinki 1, Gdansk 80-211, Poland"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6340
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 372..1688
/gene="lysA"
/label="Diaminopimelate decarboxylase"
/note="Diaminopimelate decarboxylase from Bacillus subtilis
(strain 168). Accession#: P23630"
misc_recomb complement(1806..2192)
/label="pyrD"
/note="pyrD"
promoter 2714..2818
/label="AmpR promoter"
CDS 2819..3676
/label="AmpR"
/note="beta-lactamase"
rep_origin 3850..4438
/direction=RIGHT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
misc_recomb complement(4666..5133)
/label="pyrD"
/note="pyrD"
gene 5633..6335
/gene="cotG"
/label="cotG"
regulatory 5633..5675
/gene="cotG"
/regulatory_class="promoter"
regulatory 5708..5713
/gene="cotG"
/regulatory_class="ribosome_binding_site"
CDS 5721..6335
/codon_start=1
/gene="cotG"
/product="CotG"
/label="cotG"
/note="spore coat protein"
/protein_id="AHG54622.1"
/translation="MGILELGGGGSHYSHSDIEEAVKSAKKEGLKDYLYQEPHGKKRSH
KKSHRTHKKSRSHKKSYCSHKKSRSHKKSFCSHKKSRSHKKSYCSHKKSRSHKKSYRSH
KKSRSYKKSYRSYKKSRSYKKSCRSYKKSRSYKKSYCSHKKKSRSYKKSCRTHKKSYRS
HKKYYKKPHHHCDDYKRHDDYDSKKEYWKDGNCWVVKKKYK"
misc_feature 5725..5738
/gene="cotG"
/label="multiple cloning site"
/note="multiple cloning site"
This page is informational only.