Basic Vector Information
- Vector Name:
- pCGL0243
- Antibiotic Resistance:
- Kanamycin
- Length:
- 6272 bp
- Type:
- Shuttle vector
- Replication origin:
- ColA ori
- Source/Author:
- Reyes O, Guyonvarch A, Bonamy C, Salti V, David F, Leblon G.
pCGL0243 vector Map
pCGL0243 vector Sequence
LOCUS 40924_10571 6272 bp DNA circular SYN 17-DEC-2018
DEFINITION Shuttle vector pCGL0243, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 6272)
AUTHORS Reyes O, Guyonvarch A, Bonamy C, Salti V, David F, Leblon G.
TITLE 'Integron'-bearing vectors: a method suitable for stable chromosomal
integration in highly restrictive corynebacteria
JOURNAL Gene 107 (1), 61-68 (1991)
PUBMED 1660430
REFERENCE 2 (bases 1 to 6272)
AUTHORS Ankri S, Reyes O, Leblon G.
TITLE Electrotransformation of highly DNA-restrictive corynebacteria with
synthetic DNA
JOURNAL Plasmid 35 (1), 62-66 (1996)
PUBMED 8693028
REFERENCE 3 (bases 1 to 6272)
AUTHORS Ankri S, Bouvier I, Reyes O, Predali F, Leblon G.
TITLE A Brevibacterium linens pRBL1 replicon functional in Corynebacterium
glutamicum
JOURNAL Plasmid 36 (1), 36-41 (1996)
PUBMED 8938050
REFERENCE 4 (bases 1 to 6272)
AUTHORS Reyes O.
TITLE Direct Submission
JOURNAL Submitted (09-SEP-1998) Laboratoire de Biologie Moleculaire des
Corynebacteries, Institut de Genetique et Microbiologie, Universite
de Paris-Sud, Orsay 91405, France
REFERENCE 5 (bases 1 to 6272)
TITLE Direct Submission
REFERENCE 6 (bases 1 to 6272)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Gene";
date: "1991"; volume: "107"; issue: "1"; pages: "61-68"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Plasmid";
date: "1996"; volume: "35"; issue: "1"; pages: "62-66"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Plasmid";
date: "1996"; volume: "36"; issue: "1"; pages: "36-41"
COMMENT SGRef: number: 4; type: "Journal Article"; journalName: "Submitted
(09-SEP-1998) Laboratoire de Biologie Moleculaire des
Corynebacteries, Institut de Genetique et Microbiologie, Universite
de Paris-Sud, Orsay 91405, France"
COMMENT SGRef: number: 5; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6272
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 72..88
/label=SK primer
/note="common sequencing primer, one of multiple similar
variants"
CDS complement(175..966)
/label=KanR
/note="aminoglycoside phosphotransferase"
misc_feature 1624..1920
/note="partial sequence of pACYC184 Tn9 (cat) gene from
GenBank Accession Number X06403; chloramphenicol sensitive;
BclI-ScaI fragment"
misc_feature 1921..4829
/note="cryptic plasmid pBL1 (ATCC accession 21086)
replication region; similar to Brevibacterium
lactofermentum plasmid in GenBank Accession Number X03987
(ATCC accession 13869)"
CDS complement(2369..3652)
/codon_start=1
/product="replicase"
/label=replicase
/protein_id="AAD03697.1"
/translation="MNTSKEPQVNEGSKVTRARAWRRQNVMYKITNSKALAGCHRWRRD
EAVAVSWSSNGASQFEGLQNSHSRWGSPLAELEVMGERRIELAIATKNHLAAGGALMMF
VGTVRHNRSQSFAQVEAGIKTAYSSMVKTSQWKKERARYGVEHTYSDYEVTDSWANGWH
LHRNMLLFLDRPLSDDELKAFEDSMFSRWSAGVVKAGMDAPLREHGVKLDQVSTWGGDA
AKMATYLAKGMSQELTGSATKTASKGSYTPFQMLDMLADQSDAGEDMDAVLVARWREYE
VGSKNLRSSWSRGAKRALGIDYIDADVRREMEEELYKLAGLEAPERVESTRVAVALVKP
DDWKLIQSDFAVRQYVLDCVDKAKDVAAAQRVANEVLASLGVDSTPCMIVMDDVDLDAV
LPTHGDATKRDLNAAVFAGNEQTILRTH"
rep_origin complement(5161..5695)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
rep_origin 5763..6191
/direction=RIGHT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
This page is informational only.