pEKH-rsgI6 vector (V007585)

LOCUS       V007585                10707 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V007585
VERSION     V007585
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 10707)
  AUTHORS   Sand A, Holwerda EK, Ruppertsberger NM, Maloney M, Olson DG, Nataf
            Y, Borovok I, Sonenshein AL, Bayer EA, Lamed R, Lynd LR, Shoham Y.
  TITLE     Three cellulosomal xylanase genes in Clostridium thermocellum are
            regulated by both vegetative SigA (sigma(A)) and alternative SigI6
            (sigma(I6)) factors
  JOURNAL   FEBS Lett. 589 (20), 3133-3140 (2015)
   PUBMED   26320414
REFERENCE   2  (bases 1 to 10707)
  AUTHORS   Holwerda EK.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-JUL-2015) Thayer School of Engineering, Dartmouth
            College, 14 Engineering drive, Hanover, NH 03755, USA
REFERENCE   3  (bases 1 to 10707)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 10707)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName: "FEBS
            Lett."; date: "2015"; volume: "589"; issue: "20"; pages: "3133-3140"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (24-JUL-2015) Thayer School of Engineering, Dartmouth College, 14
            Engineering drive, Hanover, NH 03755, USA"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..10707
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    11..514
                     /label="CEN/ARS"
                     /note="S. cerevisiae CEN6 centromere fused to an
                     autonomously replicating sequence"
     CDS             complement(1202..1960)
                     /gene="sigI6"
                     /label="RNA polymerase sigma factor SigI6"
                     /note="RNA polymerase sigma factor SigI6 from Acetivibrio
                     thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 /
                     NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372).
                     Accession#: A3DH98"
     CDS             2594..3241
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     CDS             3262..3807
                     /codon_start=1
                     /product="hypoxanthine phosphoribosyltransferase"
                     /EC_number="2.4.2.8"
                     /label="hypoxanthine phosphoribosyltransferase"
                     /protein_id="ALI61571.1"
                     /translation="MENLSKDIDEILITEEELKEKIKELGRQITKDYKGKNLMLVGVLK
                     GALMFMADLSRHIDLPLSLDFMAVSSYGSSTHSSGIVKIIKDLDISIEGKDVLIVEDII
                     DSGLTLSYLRETLLGRKPKSLKICTILDKPERREASVKVDYVGFKIPDKFVVGYGLDFD
                     EKYRNLPFIGVLKPEMYS"
     terminator      4703..4950
                     /label="CYC1 terminator"
                     /note="transcription terminator for CYC1"
     rep_origin      complement(5198..5786)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(5873..6451)
                     /codon_start=1
                     /product="thymidine kinase"
                     /EC_number="2.7.1.21"
                     /label="thymidine kinase"
                     /protein_id="ALI61572.1"
                     /translation="MYGPKDHGYIEVVTGPMFSGKSEELIRRIKRAKIARQKVQVFKPA
                     IDDRYSIDKVVSHNGDNMHAIAIVKASDILAYAEEDTDVFAIDEVQFFDSEIVDIVKEI
                     ADSGKRVICAGLDMDFRGEPFGPTPELMAIAEFVDKLTAICMKCGNPATRTQRLINGKP
                     ANYDDPIIMVGAKESYEARCRKCHEVPRT"
     CDS             complement(7151..8152)
                     /label="repB"
                     /note="RepB replication protein"
     CDS             complement(8713..9570)
                     /label="AmpR"
                     /note="beta-lactamase"
     CDS             complement(9669..10469)
                     /label="URA3"
                     /note="orotidine-5'-phosphate decarboxylase, required for
                     uracil biosynthesis"
     promoter        complement(10470..10685)
                     /label="URA3 promoter"