pEAI3-S54 vector (V007698)

LOCUS       V007698                 7803 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V007698
VERSION     V007698
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7803)
  AUTHORS   Derouazi M, Toussaint B, Quenee L, Epaulard O, Guillaume M, Marlu R,
            Polack B.
  TITLE     High-yield production of secreted active proteins by the Pseudomonas
            aeruginosa type III secretion system
  JOURNAL   Appl. Environ. Microbiol. 74 (11), 3601-3604 (2008)
   PUBMED   18390679
REFERENCE   2  (bases 1 to 7803)
  AUTHORS   Toussaint B, Le Gouellec A, Polack B.
  TITLE     Direct Submission
  JOURNAL   Submitted (07-FEB-2012) TIMC-TheREx Laboratory, Universite Joseph
            Fourier, Doamine de la merci, La Tronche 38700, France
REFERENCE   3  (bases 1 to 7803)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7803)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
            Environ. Microbiol."; date: "2008"; volume: "74"; issue: "11";
            pages: "3601-3604"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (07-FEB-2012) TIMC-TheREx Laboratory, Universite Joseph Fourier,
            Doamine de la merci, La Tronche 38700, France"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7803
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             1..162
                     /codon_start=1
                     /gene="exoS"
                     /product="ExoS54"
                     /label="exoS"
                     /note="secretion tag; first 54 amino acid of ExoS"
                     /protein_id="AFD22622.1"
                     /translation="MHIQSLQQSPSFAVELHQAASGRLGQIEARQVATPSEAQQLAQRQ
                     DAPKGEGLL"
     gene            1..162
                     /gene="exoS"
                     /label="exoS"
     primer_bind     complement(211..227)
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             complement(391..1221)
                     /label="pRO1600 Rep"
                     /note="replication protein for the broad-host-range plasmid
                     pRO1600 from Pseudomonas aeruginosa"
     rep_origin      1235..1586
                     /label="pRO1600 oriV"
                     /note="broad-host-range origin of replication from
                     Pseudomonas aeruginosa plasmid pRO1600; requires the
                     pRO1600 Rep protein for replication (West et al., 1994)"
     promoter        1913..2017
                     /label="AmpR promoter"
     CDS             2018..2875
                     /label="AmpR"
                     /note="beta-lactamase"
     rep_origin      3049..3637
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     protein_bind    3925..3946
                     /label="CAP binding site"
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        3961..3991
                     /label="lac promoter"
                     /note="promoter for the E. coli lac operon"
     protein_bind    3999..4015
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     4023..4039
                     /label="M13 rev"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             complement(4070..5149)
                     /label="lacI"
                     /note="lac repressor"
     promoter        complement(5150..5227)
                     /label="lacIq promoter"
                     /note="In the lacIq allele, a single base change in the
                     promoter boosts expression of the lacI gene about 10-fold."
     terminator      complement(5596..5623)
                     /label="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(5716..5802)
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     primer_bind     6203..6219
                     /label="M13 fwd"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     CDS             complement(6240..7073)
                     /gene="exsA"
                     /label="HTH-type transcriptional regulator ExsA"
                     /note="HTH-type transcriptional regulator ExsA from
                     Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP
                     104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1).
                     Accession#: P26993"
     protein_bind    complement(7108..7124)
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     CDS             complement(7266..7616)
                     /codon_start=1
                     /product="SpcS"
                     /label="SpcS"
                     /protein_id="AFD22626.1"
                     /translation="MNPLYRAAIHQLFLALDLPTPNDEESVLSLQVGPHLCHLAEHPTD
                     HLLMFTRLEGQGDATASEQNLFSQDPCKPILGRDPESGERLLWNRQPLQLLDRAQIHHQ
                     LEQLVAAAEELR"