pDV-CTAP vector (V007717)

LOCUS       40924_16340        7307 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pDV-CTAP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7307)
  AUTHORS   Meima ME, Weening KE, Schaap P.
  TITLE     Vectors for expression of proteins with single or combinatorial 
            fluorescent protein and tandem affinity purification tags in 
            Dictyostelium
  JOURNAL   Protein Expr. Purif. 53 (2), 283-288 (2007)
  PUBMED    17296313
REFERENCE   2  (bases 1 to 7307)
  AUTHORS   Meima ME, Weening KE, Schaap P.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-SEP-2006) School of Life Sciences, University of 
            Dundee, Dow Street, Dundee DD1 5EH, United Kingdom
REFERENCE   3  (bases 1 to 7307)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7307)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Protein 
            Expr. Purif."; date: "2007"; volume: "53"; issue: "2"; pages: 
            "283-288"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (27-SEP-2006) School of Life Sciences, University of Dundee, Dow 
            Street, Dundee DD1 5EH, United Kingdom"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7307
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    15..50
                     /label=multipe cloning site
                     /note="multipe cloning site"
     CDS             54..131
                     /label=CBP
                     /note="calmodulin-binding peptide"
     CDS             159..179
                     /label=TEV site
                     /note="tobacco etch virus (TEV) protease recognition and 
                     cleavage site"
     CDS             219..392
                     /label=ProtA
                     /note="IgG-binding unit of Staphylococcus aureus protein A"
     CDS             396..566
                     /codon_start=1
                     /product="IgG-binding unit of Staphylococcus aureus protein
                     A"
                     /label=ProtA
                     /translation="DNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLA
                     EAKKLNGAQAPK"
     regulatory      617..1597
                     /label=2H3 terminator
                     /note="2H3 terminator"
                     /regulatory_class="terminator"
     CDS             2366..3157
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     promoter        4050..4154
                     /label=AmpR promoter
     CDS             4155..5012
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      5186..5774
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     regulatory      6999..7307
                     /label=actin15 promoter
                     /note="actin15 promoter"
                     /regulatory_class="promoter"