pDP28 vector (V007934)

LOCUS       V007934                 7790 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V007934
VERSION     V007934
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7790)
  AUTHORS   Manso AS, Iannelli F, Pozzi G, Furi L, Oggioni MR.
  TITLE     The nucleotide sequence of the Streptococcus pneumoniae Escherichia
            coli shuttle vector pDP28
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 7790)
  AUTHORS   Manso AS, Iannelli F, Pozzi G, Furi L, Oggioni MR.
  TITLE     Direct Submission
  JOURNAL   Submitted (30-JAN-2014) Department of Genetics, University of
            Leicester, Adrian Building, University Road, Leicester LE1 7RH, UK
REFERENCE   3  (bases 1 to 7790)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 7790)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing
            ##Assembly-Data-END##
            SGRef: number: 1; type: "Journal Article"; journalName:
            "Unpublished"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (30-JAN-2014) Department of Genetics, University of Leicester,
            Adrian Building, University Road, Leicester LE1 7RH, UK"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..7790
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..2392
                     /note="HindIII-SalI fragment of plasmid pSMB1 in INSDC
                     accession AF047385"
     rep_origin      184..201
                     /note="double strand replication origin of pneumococcal
                     plasmids pDP1 and pSMB1"
     CDS             403..1365
                     /codon_start=1
                     /gene="rep"
                     /product="replication protein"
                     /label="rep"
                     /note="REP pDP1 pSMB1"
                     /protein_id="AHX11846.1"
                     /translation="MEKWENQDKILLDKNKRGKDRNWRGRKLLSLKLADIFKELGYRET
                     LIERVETCGDTLRFIRREDGSLRLYQAYFCKNKLCPMCNWRRSMKYSYQTSQIVDEAIK
                     EQPKGRFLFLTLTVKNVPGKELNATISQLTQSFDRLFRRAKVKKNLIGFLRSVEVTHNQ
                     EEETYHPHIHVLMMVKSSYFSGAGDNYVSQEEWGRMWEQSLKVDYVPMVDIRSVKEIGK
                     GLKGAILETAKYPIKPIKLDVENKQVVGDLYNGLYRKRQLGYGGLFKEIRKRLQLSNVE
                     NGDLVYTSDDNDEMSKGTKIVAIWNATKQNYFVKNKGWN"
     gene            403..1365
                     /gene="rep"
                     /label="rep"
     rep_origin      2352..2392
                     /note="single strand replication origin of pneumococcal
                     plasmids pDP1 and pSMB1"
     CDS             complement(4050..4706)
                     /label="CmR"
                     /note="chloramphenicol acetyltransferase"
     promoter        complement(4707..4809)
                     /label="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      complement(5335..5880)
                     /direction=LEFT
                     /label="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(6142..6876)
                     /gene="ermBP"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"