Basic Vector Information
- Vector Name:
- pDM2L
- Antibiotic Resistance:
- Tetracycline
- Length:
- 12210 bp
- Type:
- Cloning vector
- Replication origin:
- ori2
- Source/Author:
- Chan CT, Lee JW, Cameron DE, Bashor CJ, Collins JJ.
pDM2L vector Map
pDM2L vector Sequence
LOCUS 40924_14800 12210 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector pDM2L, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 12210)
AUTHORS Chan CT, Lee JW, Cameron DE, Bashor CJ, Collins JJ.
TITLE 'Deadman' and 'Passcode' microbial kill switches for bacterial
containment
JOURNAL Nat. Chem. Biol. 12 (2), 82-86 (2016)
PUBMED 26641934
REFERENCE 2 (bases 1 to 12210)
AUTHORS Chan CTY., Lee JW, Cameron DE, Bashor CJ, Collins JJ.
TITLE Direct Submission
JOURNAL Submitted (12-OCT-2015) Biological engineering, MIT, 45 Carleton St,
MIT Building E25-Rm302, Cambridge, MA 02142, USA
REFERENCE 3 (bases 1 to 12210)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 12210)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat. Chem.
Biol."; date: "2016"; volume: "12"; issue: "2"; pages: "82-86"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-OCT-2015) Biological engineering, MIT, 45 Carleton St, MIT
Building E25-Rm302, Cambridge, MA 02142, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..12210
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(105..1073)
/label=sopB
/note="partitioning protein for the bacterial F plasmid"
CDS complement(1076..2248)
/label=sopA
/note="partitioning protein for the bacterial F plasmid"
misc_feature complement(2574..2824)
/label=incC
/note="incompatibility region of the bacterial F plasmid"
CDS complement(2830..3582)
/label=repE
/note="replication initiation protein for the bacterial F
plasmid"
rep_origin complement(3673..3892)
/direction=LEFT
/label=ori2
/note="secondary origin of replication for the bacterial F
plasmid; also known as oriS"
rep_origin complement(3968..4582)
/direction=LEFT
/label=oriV
/note="origin of replication for the bacterial F plasmid"
promoter 5440..5542
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS 5543..6199
/label=CmR
/note="chloramphenicol acetyltransferase"
terminator complement(6337..6431)
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
CDS complement(6494..7207)
/label=yeGFP
/note="yeast-enhanced green fluorescent protein"
RBS 7213..7221
/label=Shine-Dalgarno sequence
/note="full consensus sequence for ribosome-binding sites
upstream of start codons in E. coli; complementary to a
region in the 3' end of the 16S rRNA (Chen et al., 1994)"
regulatory complement(7249..7322)
/label=PLtetO promoter
/note="PLtetO promoter"
/regulatory_class="promoter"
promoter complement(7249..7322)
/label=PLtetO-1 promoter
/note="modified phage lambda PL promoter with tet operator
sites (Lutz and Bujard, 1997)"
misc_feature 7268
/label=transcription start site
/note="transcription start site"
protein_bind 7304..7322
/gene="tetO"
/label=tet operator
/bound_moiety="tetracycline repressor TetR"
/note="bacterial operator O2 for the tetR and tetA genes"
misc_feature complement(7365..7448)
/label=ssrA tag (mf-lon)
/note="ssrA tag (mf-lon)"
CDS complement(7449..8528)
/label=lacI
/note="lac repressor"
RBS 8534..8542
/label=Shine-Dalgarno sequence
/note="full consensus sequence for ribosome-binding sites
upstream of start codons in E. coli; complementary to a
region in the 3' end of the 16S rRNA (Chen et al., 1994)"
promoter complement(8564..8637)
/label=PLtetO-1 promoter
/note="modified phage lambda PL promoter with tet operator
sites (Lutz and Bujard, 1997)"
promoter 8669..8698
/label=trc promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
misc_feature 8704
/label=transcription start site
/note="transcription start site"
protein_bind 8706..8722
/label=lac operator
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
RBS 8755..8763
/label=Shine-Dalgarno sequence
/note="full consensus sequence for ribosome-binding sites
upstream of start codons in E. coli; complementary to a
region in the 3' end of the 16S rRNA (Chen et al., 1994)"
CDS 8769..9389
/label=TetR
/note="tetracycline repressor TetR"
regulatory 9397..9509
/label=rnpBT1 terminator
/note="rnpBT1 terminator"
/regulatory_class="terminator"
protein_bind 9528..9547
/label=lac operator (symmetric)
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
protein_bind 9564..9583
/label=lac operator (symmetric)
/bound_moiety="lac repressor encoded by lacI"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
promoter 9584..9613
/label=trc promoter
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
protein_bind complement(9620..9639)
/label=lac operator (symmetric)
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG). The
symmetric lac operator was optimized for tight binding of
lac repressor."
RBS 9656..9664
/label=Shine-Dalgarno sequence
/note="full consensus sequence for ribosome-binding sites
upstream of start codons in E. coli; complementary to a
region in the 3' end of the 16S rRNA (Chen et al., 1994)"
CDS 9668..12031
/codon_start=1
/product="protease"
/label=protease
/note="derived from Mesoplasma florum lon codon optimized"
/protein_id="ALP32215.1"
/translation="MSKKIKLPIFQIRGSFIVPGIKENLEVGRKNTLASVNYAIKNSNN
QMIAIPQIDASVEKPEFSDLHEFGILIDFEVIKEWKDNSLTISTNPIQRCKVISFFENE
DQVPYAEVELIESINDFSDEELKELIEKISDAIKTKASLVTKQIKQLISGESDDLSLAF
DSIMFKLAPSKILTNPEYITSPSLKTRWSIIEKIIFAEDGIITRNAESIDAARQKNEIE
QELNHKLKEKMDKQQKEYYLREKMRIIKDELEDEDDSDDSSLEKYKERLAKEPFPEEVK
RKIMASIKRVEALQSGTPEWNTEKNYIDWMMSIPWWEETEDLTDLKYAKKILDKHHYGM
KKVKERIIEYLAVKTKTKSLKAPIITLVGPPGVGKTSLAKSIAEAVGKNFVKVSLGGVK
DESEIRGHRKTYVGSMPGRIIQTMKRAKVKNPLFLLDEIDKMASDHRGDPASAMLEVLD
PEQNKEFSDHYIEEPYDLSQVMFIATANYPEDIPEALYDRMEIINLSSYTEIEKVKIAQ
DYLVPKAIEQHELTSEEISFTEGAINEIIKYYTREAGVRQLERHINSIIRKYIVKNLNG
EMDKIVIDEKQVNDLLGKRIFDHTEKQEESQIGVVTGLAYTQFGGDILPIEVSLYPGKG
NLILTGKLGEVMKESATIALTYVKSNFEKFGVDKKVFEENDIHVHVPEGAVPKDGPSAG
ITITTALISALSDKPVSKEIGMTGEITLRGNVLPIGGLREKSISASRSGLKTIIIPKKN
ERDLDEIPDEVKAKLKIIPAEKYEEVFAIVFKTK"
terminator 12068..12154
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
This page is informational only.