Basic Vector Information
- Vector Name:
- pCV3
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 5332 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- VanDrisse CM, Escalante-Semerena JC.
- Promoter:
- araBAD
pCV3 vector Map
pCV3 vector Sequence
LOCUS 40924_13850 5332 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pCV3, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5332)
AUTHORS VanDrisse CM, Escalante-Semerena JC.
TITLE New high-cloning-efficiency vectors for complementation studies and
recombinant protein overproduction in Escherichia coli and
Salmonella enterica
JOURNAL Plasmid (2016) In press
PUBMED 27234933
REFERENCE 2 (bases 1 to 5332)
AUTHORS VanDrisse CM, Escalante-Semerena JC.
TITLE Direct Submission
JOURNAL Submitted (24-MAR-2016) Microbiology, University of Georgia, 120
Cedar St., Athens, GA 30602, USA
REFERENCE 3 (bases 1 to 5332)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5332)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plasmid
(2016) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(24-MAR-2016) Microbiology, University of Georgia, 120 Cedar St.,
Athens, GA 30602, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5332
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator 240..326
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 418..445
/label=rrnB T2 terminator
/note="transcription terminator T2 from the E. coli rrnB
gene"
promoter 464..555
/label=AmpR promoter
rep_origin 1009..1464
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
CDS complement(2022..2678)
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
promoter complement(2679..2781)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
rep_origin complement(3307..3852)
/direction=LEFT
/label=p15A ori
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS complement(4126..5001)
/codon_start=1
/label=araC
/note="L-arabinose regulatory protein"
/translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
ILNLTIRGQGVVKNQGREFVCRPGDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
EKVNDVAVKLS"
promoter 5028..5312
/label=araBAD promoter
/note="promoter of the L-arabinose operon of E. coli; the
araC regulatory gene is transcribed in the opposite
direction (Guzman et al., 1995)"
This page is informational only.