Basic Vector Information
- Vector Name:
- pBhSV-2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5038 bp
- Type:
- Shuttle vector
- Replication origin:
- ori
- Source/Author:
- Battisti JM, Raffel SJ, Schwan TG.
pBhSV-2 vector Map
pBhSV-2 vector Sequence
LOCUS 40924_6357 5038 bp DNA circular SYN 17-DEC-2018
DEFINITION Shuttle vector pBhSV-2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5038)
AUTHORS Battisti JM, Raffel SJ, Schwan TG.
TITLE A System for Site-Specific Genetic Manipulation of the Relapsing
Fever Spirochete Borrelia hermsii
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5038)
AUTHORS Battisti JM, Raffel SJ, Schwan TG.
TITLE Direct Submission
JOURNAL Submitted (09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky
Mountain Laboratories, National Institute of Allergy and Infectious
Diseases, National Institutes of Health, 903 S. 4th Street,
Hamilton, MT 59840, USA
REFERENCE 3 (bases 1 to 5038)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5038)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(09-MAR-2007) Laboratory of Zoonotic Pathogens, Rocky Mountain
Laboratories, National Institute of Allergy and Infectious Diseases,
National Institutes of Health, 903 S. 4th Street, Hamilton, MT
59840, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5038
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(61..649)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(790..1161)
/label=BleoR
/note="antibiotic-binding protein"
CDS complement(1421..2227)
/label=KanR
/note="aminoglycoside phosphotransferase"
regulatory complement(2228..2348)
/label=flgB promoter derived from Borrelia hermsii
/note="flgB promoter derived from Borrelia hermsii"
/regulatory_class="promoter"
gene complement(2605..3114)
/pseudo
/gene="vmp"
/label=vmp
/note="orfC'"
RBS 2684..2692
/label=Shine-Dalgarno sequence
/note="full consensus sequence for ribosome-binding sites
upstream of start codons in E. coli; complementary to a
region in the 3' end of the 16S rRNA (Chen et al., 1994)"
CDS 3281..4375
/codon_start=1
/product="hypothetical protein"
/label=hypothetical protein
/note="similar to gene family 57; orfA"
/protein_id="ABS71230.1"
/translation="MGNTKKFTNKYQHKLIVLISTLNYMNLKLKKYTQNDILYYFNNNM
KKNDQNPIKLKTLQSYLYKLKKEFQVTINYHRHLGVNMGTEIHYELKYSKKECYCIINK
QFREKKEERHKKRVNVYLEKTCIKNSSVEKWECSYNIYNNKEEKKDIKEIEKLQVKKYI
RKCNFKSDILYSILDLELEKNATIKVCKIIKRTENFIENSIYKRINGIKSNRSKQRELS
KILNETRIRLENEGHNGKQLETQIQEVYEQYKNKPHFIIENNKYNDLKKIIGKLKKTVE
YTNRNAKENERDVRNNVFSILLEQLRHKVDKSILVSILKGYLNKQDKLTYSKALNNYYY
HELLELINNNLDYLKPEKLEIITS"
CDS 4385..4945
/codon_start=1
/gene="orfB"
/product="hypothetical protein"
/label=orfB
/note="simlar to gene family 50; orfB"
/protein_id="ABS71231.1"
/translation="MESILERLKKKESEIKKKNNRNLFVKVEKINNRTIYHTKIMKDLF
SFGINKNQRGKFFVSFRELFNQEKIAVFNLFSLRDDDKFLGISYWYRKPIQNVVTRYEE
NGIMKASTFSKVYYVEFRFKKGSVCCYIGEITYLLRKEKANKKYYESLVERMINLEKQV
YEFYGKKLPNGGIINKWIEKNQK"
gene 4385..4945
/gene="orfB"
/label=orfB
This page is informational only.