pBGS18 vector (V009206)

LOCUS       40924_6327        4336 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pBGS18, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4336)
  AUTHORS   Curiao TIG., Coque T.
  TITLE     The complete sequence of the common cloning vector pBGS18
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4336)
  AUTHORS   Curiao TIG.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2014) Microbiology, University Hospital Ramn y 
            Cajal, Crtra Colmenar Viejo, Km 9, 100, Madrid, Madrid 28034, Spain
REFERENCE   3  (bases 1 to 4336)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4336)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (29-OCT-2014) Microbiology, University Hospital Ramn y Cajal, Crtra 
            Colmenar Viejo, Km 9, 100, Madrid, Madrid 28034, Spain"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Assembly Method       :: Blast v. January 2013
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..4336
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(354..783)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     rep_origin      1166..1754
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(1940..2082)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     protein_bind    2325..2346
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        2361..2391
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    2399..2415
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     2423..2439
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    2449..2505
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(2509..2525)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             complement(3086..3898)
                     /codon_start=1
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"