pBBR1MCS-Erm vector (V009255)

LOCUS       Exported                4811 bp DNA     circular SYN 05-AUG-2024
DEFINITION  Exported.
ACCESSION   V009255
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4811)
  AUTHORS   Yero D, Ferrer-Navarro M, Costenaro L, Planell R, Conchillo-Sole O, 
            Sole M, Roca I, Gibert I, Daura X.
  TITLE     A transport system associated with the intrinsic antimicrobial 
            multiresistance in Pseudomonas aeruginosa
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 4811)
  AUTHORS   Yero D, Gibert I.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-DEC-2016) Genetica Molecular Bacteriana, Institut de 
            Biotecnologia i de Biomedicina (IBB), Campus UAB, Bellaterra, 
            Barcelona 08191, Spain
REFERENCE   3  (bases 1 to 4811)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 4811)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 4811)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (20-DEC-2016) Genetica Molecular Bacteriana, Institut de 
            Biotecnologia i de Biomedicina (IBB), Campus UAB, Bellaterra, 
            Barcelona 08191, Spain"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4811
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     primer_bind     100..116
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        126..144
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    153..260
                     /label=MCS
                     /note="pBluescript multiple cloning site"
     CDS             402..1136
                     /gene="ermBP"
                     /label=rRNA adenine N-6-methyltransferase
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis. Accession#: P0A4D5"
     CDS             complement(1544..2548)
                     /codon_start=1
                     /product="mob encodes the plasmid mobilization functions
                     that allow conjugal delivery of the plasmids into a variety
                     of bacteria from E. coli strains harboring the RK2 conjugal
                     transfer functions."
                     /label=mob
                     /translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW
                     AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA
                     DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA
                     DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR
                     VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP
                     LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLAAL"
     promoter        complement(2616..2667)
                     /label=promoter for mob
     misc_feature    2627..2649
                     /label=RSA
                     /note="transfer origins (also called recombination site A 
                     [RSA]), is known as the specific site necessary for 
                     mobilization and recombination mediated by a Mob/Pre 
                     protein. "
     rep_origin      2772..3541
                     /label=pBBR1 oriV
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"
     CDS             3542..4201
                     /label=pBBR1 Rep
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"