pBBR1-acs vector (Cat. No.: V009266)
Basic Information
- Name:
- pBBR1-acs
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 6628 bp
- Type:
- Cloning vector
- Replication origin:
- pBBR1 oriV
- Source/Author:
- Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
pBBR1-acs vector (Cat. No.: V009266) Sequence
LOCUS V009266 6628 bp DNA circular SYN 17-DEC-2018
DEFINITION Exported.
ACCESSION V009266
VERSION V009266
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 6628)
AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
TITLE Repurposing type III polyketide synthase as a malonyl-CoA biosensor
for metabolic engineering in bacteria
JOURNAL Proc. Natl. Acad. Sci. U.S.A. (2018) In press
PUBMED 30232266
REFERENCE 2 (bases 1 to 6628)
AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
TITLE Novel Enzyme-coupled Malonyl-CoA Biosensor based on Type III
Polyketide Synthase and Use of the same (KR 10-2018-0066323)
JOURNAL Unpublished
REFERENCE 3 (bases 1 to 6628)
AUTHORS Yang D, Kim WJ, Yoo SM, Choi JH, Ha SH, Lee MH, Lee SY.
TITLE Direct Submission
JOURNAL Submitted (19-JUL-2018) Dept. Chemical and Biomolecular Engineering,
Korea Advanced Institute of Science and Technology, Daehak-ro 291,
Daejeon 34141, South Korea
REFERENCE 4 (bases 1 to 6628)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 6628)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
Acad. Sci. U.S.A. (2018) In press"
SGRef: number: 2; type: "Journal Article"; journalName:
"Unpublished"
SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(19-JUL-2018) Dept. Chemical and Biomolecular Engineering, Korea
Advanced Institute of Science and Technology, Daehak-ro 291, Daejeon
34141, South Korea"
SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..6628
/mol_type="other DNA"
/organism="synthetic DNA construct"
promoter 2..30
/label="tac promoter"
/note="strong E. coli promoter; hybrid between the trp and
lac UV5 promoters"
protein_bind 38..54
/label="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
CDS 77..2032
/gene="acs"
/label="Acetyl-coenzyme A synthetase"
/note="Acetyl-coenzyme A synthetase from Escherichia coli
(strain K12). Accession#: P27550"
terminator 2284..2370
/label="rrnB T1 terminator"
/note="transcription terminator T1 from the E. coli rrnB
gene"
terminator 2462..2489
/label="rrnB T2 terminator"
/note="transcription terminator T2 from the E. coli rrnB
gene"
protein_bind complement(2510..2531)
/label="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
CDS complement(2645..3277)
/label="CmR"
/note="chloramphenicol acetyltransferase"
promoter complement(3278..3380)
/label="cat promoter"
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
CDS complement(3530..4549)
/codon_start=1
/gene="mob"
/product="Mob"
/function="required for plasmid mobilization"
/label="mob"
/protein_id="AYD60210.1"
/translation="MAAYAIMRCKKLAKMGNVAASLKHAYRERETPNADASRTPENEHW
AASSTDEAMGRLRELLPEKRRKDAVLAVEYVMTASPEWWKSASQEQQAAFFEKAHKWLA
DKYGADRIVTASIHRDETSPHMTAFVVPLTQDGRLSAKEFIGNKAQMTRDQTTFAAAVA
DLGLQRGIEGSKARHTRIQAFYEALERPPVGHVTISPQAVEPRAYAPQGLAEKLGISKR
VETPEAVADRLTKAVRQGYEPALQAAAGAREMRKKADQAQETARDLRERLKPVLDALGP
LNRDMQAKAAAIIKAVGEKLLTEQREVQRQKQAQRQQERGRAHFPEKCHLTSKKPLLS"
gene complement(3530..4549)
/gene="mob"
/label="mob"
rep_origin 4773..5544
/label="pBBR1 oriV"
/note="replication origin of the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica; requires the pBBR1
Rep protein for replication"
CDS 5545..6204
/label="pBBR1 Rep"
/note="replication protein for the broad-host-range plasmid
pBBR1 from Bordetella bronchiseptica"
This page is informational only.