pBAD24-Gluc vector (V009299)

LOCUS       40924_5799        5013 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pBAD24-Gluc, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5013)
  AUTHORS   Wille T, Blank K, Schmidt C, Vogt V, Gerlach RG.
  TITLE     Gaussia princeps Luciferase as a Reporter for Transcriptional 
            Activity, Protein Secretion, and Protein-Protein Interactions in 
            Salmonella enterica Serovar Typhimurium
  JOURNAL   Appl. Environ. Microbiol. 78 (1), 250-257 (2012)
  PUBMED    22020521
REFERENCE   2  (bases 1 to 5013)
  AUTHORS   Wille T, Blank K, Schmidt C, Gerlach RG.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-MAY-2010) Junior Research Group 3, Robert 
            Koch-Institute, Burgstrasse 37, Wernigerode, Saxony-Anhalt 38855, 
            Germany
REFERENCE   3  (bases 1 to 5013)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5013)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol."; date: "2012"; volume: "78"; issue: "1"; pages:
            "250-257"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (19-MAY-2010) Junior Research Group 3, Robert Koch-Institute, 
            Burgstrasse 37, Wernigerode, Saxony-Anhalt 38855, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5013
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             complement(99..974)
                     /label=araC
                     /note="L-arabinose regulatory protein"
     promoter        1001..1285
                     /label=araBAD promoter
                     /note="promoter of the L-arabinose operon of E. coli; the
                     araC regulatory gene is transcribed in the opposite 
                     direction (Guzman et al., 1995)"
     regulatory      1306..1311
                     /regulatory_class="ribosome_binding_site"
     CDS             1319..1828
                     /codon_start=1
                     /gene="Gluc"
                     /product="Gluc"
                     /label=Gluc
                     /note="luciferase; derived from Gaussia princeps; codon 
                     optimized for Salmonella enterica expression"
                     /protein_id="AEA02464.1"
                     /translation="MKPTENNEDFNIVAVASNFATTDLDADRGKLPGKKLPLEVLKEME
                     ANARKAGCTRGCLICLSHIKCTPKMKKFIPGRCHTYEGDKESAQGGIGEAIVDIPEIPG
                     FKDLEPMEQFIAQVDLCVDCTTGCLKGLANVQCSDLLKKWLPQRCATFASKIQGQVDKI
                     KGAGGD"
     gene            1319..1828
                     /gene="Gluc"
                     /label=Gluc
     terminator      2040..2126
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      2218..2245
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        2264..2355
                     /label=AmpR promoter
     CDS             2356..3213
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      3258..3713
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     rep_origin      3824..4412
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"