paT7P-2 vector (Cat. No.: V009411)
Basic Information
- Name:
- paT7P-2
- Antibiotic Resistance:
- Kanamycin
- Length:
- 5502 bp
- Type:
- Expression vector
- Replication origin:
- ori
- Source/Author:
- Han T, Chen Q, Liu H.
paT7P-2 vector (Cat. No.: V009411) Sequence
LOCUS 40924_4984 5502 bp DNA circular SYN 18-DEC-2018
DEFINITION Expression vector paT7P-2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5502)
AUTHORS Han T, Chen Q, Liu H.
TITLE Engineered photoactivatable genetic switches based on the bacterium
phage T7 RNA polymerase
JOURNAL ACS Synth Biol (2016) In press
PUBMED 27794600
REFERENCE 2 (bases 1 to 5502)
AUTHORS Han T, Chen Q, Liu H.
TITLE Direct Submission
JOURNAL Submitted (11-OCT-2016) School of Life Sciences, University of
Science and Technology of China, University of Science and
Technology of China, No.96, JinZhai Road Baohe District,Hefei,Anhui,
230026,P.R.China, Hefei, Anhui 230026, China
REFERENCE 3 (bases 1 to 5502)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5502)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "ACS Synth
Biol (2016) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(11-OCT-2016) School of Life Sciences, University of Science and
Technology of China, University of Science and Technology of China,
No.96, JinZhai Road Baohe District,Hefei,Anhui, 230026,P.R.China,
Hefei, Anhui 230026, China"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Assembly Method :: Vector NTI v. Vector NTI Advance (TM) 11.0
Assembly Name :: paT7P-2
Coverage :: 5502bp
Sequencing Technology :: 454
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5502
/mol_type="other DNA"
/organism="synthetic DNA construct"
terminator complement(73..116)
/label=bacterial terminator
/note="putative bacterial transcription terminator"
regulatory 125..168
/regulatory_class="promoter"
regulatory 179..190
/regulatory_class="ribosome_binding_site"
RBS 179..190
/note="strong bacterial ribosome binding site (Elowitz and
Leibler, 2000)"
CDS 1925..2374
/label=pMag
/note="'positive Magnet' variant of an N-terminally
truncated Vivid (VVD) blue light photoreceptor from
Neurospora crassa (Kawano et al., 2015)"
regulatory 2419..2430
/regulatory_class="ribosome_binding_site"
RBS 2419..2430
/note="strong bacterial ribosome binding site (Elowitz and
Leibler, 2000)"
CDS 2437..3399
/codon_start=1
/product="C565"
/label=C565
/note="C565 fragment of T7 RNAP"
/protein_id="APD28472.1"
/translation="METVQDIYGIVAKKVNEILQADAINGTDNEVVTVTDENTGEISEK
VKLGTKALAGQWLAYGVTRSVTKRSVMTLAYGSKEFGFRQQVLEDTIQPAIDSGKGLMF
TQPNQAAGYMAKLIWESVSVTVVAAVEAMNWLKSAAKLLAAEVKDKKTGEILRKRCAVH
WVTPDGFPVWQEYKKPIQTRLNLMFLGQFRLQPTINTNKDSEIDAHKQESGIAPNFVHS
QDGSHLRKTVVWAHEKYGIESFALIHDSFGTIPADAANLFKAVRETMVDTYESCDVLAD
FYDQFADQLHESQLDKMPALPAKGNLNLRDILESDFAFA"
regulatory 3406..3439
/regulatory_class="terminator"
misc_feature 3439..3459
/label=BioBrick suffix
/note="universal suffix for all parts"
terminator 3460..3517
/label=his operon terminator
/note="This putative transcriptin terminator from the E.
coli his operon has a 2-bp deletion introduced during
synthesis. Its efficiency has not been determined."
rep_origin complement(3712..4300)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4536..5348)
/label=KanR
/note="aminoglycoside phosphotransferase"
This page is informational only.