pAT101 vector (V009417)

LOCUS       V009417                 4976 bp    DNA     circular SYN 18-DEC-2018
DEFINITION  Exported.
ACCESSION   V009417
VERSION     V009417
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 4976)
  AUTHORS   Tooley AJ, Cai YA, Glazer AN.
  TITLE     Biosynthesis of a fluorescent cyanobacterial C-phycocyanin
            holo-alpha subunit in a heterologous host
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 98 (19), 10560-10565 (2001)
   PUBMED   11553806
REFERENCE   2  (bases 1 to 4976)
  AUTHORS   Tooley AJ, Glazer AN.
  TITLE     Biosynthesis of the cyanobacterial light-harvesting polypeptide
            phycoerythrocyanin holo-alpha subunit in a heterologous host
  JOURNAL   J. Bacteriol. 184 (17), 4666-4671 (2002)
   PUBMED   12169589
REFERENCE   3  (bases 1 to 4976)
  AUTHORS   Tooley AJ, Glazer AN.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2003) Molecular and Cell Biology, University of
            California, Berkeley, 142 LSA no. 3200, Berkeley, CA 94720-3200, USA
REFERENCE   4  (bases 1 to 4976)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 4976)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "2001"; volume: "98"; issue: "19"; pages:
            "10560-10565"
            SGRef: number: 2; type: "Journal Article"; journalName: "J.
            Bacteriol."; date: "2002"; volume: "184"; issue: "17"; pages:
            "4666-4671"
            SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (18-MAY-2003) Molecular and Cell Biology, University of California,
            Berkeley, 142 LSA no. 3200, Berkeley, CA 94720-3200, USA"
            SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..4976
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      71..616
                     /label="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     CDS             1211..2023
                     /label="KanR"
                     /note="aminoglycoside phosphotransferase"
     regulatory      2790..2795
                     /label="trc promoter"
                     /note="trc promoter"
                     /regulatory_class="minus_35_signal"
     regulatory      2813..2819
                     /label="trc promoter"
                     /note="trc promoter"
                     /regulatory_class="minus_10_signal"
     misc_feature    2825..2826
                     /label="transcription initiation site from trc promoter"
                     /note="transcription initiation site from trc promoter"
     protein_bind    2827..2843
                     /label="lac operator"
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be
                     relieved by adding lactose or
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     regulatory      2852..2857
                     /gene="hox1"
                     /regulatory_class="ribosome_binding_site"
     CDS             2870..2887
                     /label="6xHis"
                     /note="6xHis affinity tag"
     CDS             2909..2929
                     /label="TEV site"
                     /note="tobacco etch virus (TEV) protease recognition and
                     cleavage site"
     CDS             2936..3655
                     /gene="pbsA1"
                     /label="Heme oxygenase 1"
                     /note="Heme oxygenase 1 from Synechocystis sp. (strain PCC
                     6803 / Kazusa). Accession#: P72849"
     gene            3677..4436
                     /gene="pcyA"
                     /label="pcyA"
                     /note="slr0116"
     regulatory      3677..3682
                     /gene="pcyA"
                     /regulatory_class="ribosome_binding_site"
     CDS             3690..4436
                     /codon_start=1
                     /gene="pcyA"
                     /product="3Z-phycocyanobilin:ferredoxin oxidoreductase"
                     /label="pcyA"
                     /note="PcyA; catalyzes the conversion of biliverdin to
                     3Z-phycocyanobilin"
                     /protein_id="AAP45708.1"
                     /translation="MAVTDLSLTNSSLMPTLNPMIQQLALAIAASWQSLPLKPYQLPED
                     LGYVEGRLEGEKLVIENRCYQTPQFRKMHLELAKVGKGLDILHCVMFPEPLYGLPLFGC
                     DIVAGPGGVSAAIADLSPTQSDRQLPAAYQKSLAELGQPEFEQQRELPPWGEIFSEYCL
                     FIRPSNVTEEERFVQRVVDFLQIHCHQSIVAEPLSEAQTLEHRQGQIHYCQQQQKNDKT
                     RRVLEKAFGEAWAERYMSQVLFDVIQ"
     terminator      4713..4799
                     /label="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      4891..4918
                     /label="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"