pART3 vector (V009449)

LOCUS       40924_4779        5406 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Inducible expression vector pART3, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5406)
  AUTHORS   Sandu C, Chiribau CB, Brandsch R.
  TITLE     Characterization of HdnoR, the transcriptional repressor of the 
            6-hydroxy-D-nicotine oxidase gene of Arthrobacter nicotinovorans 
            pAO1, and its DNA-binding activity in response to L- and D-nicotine 
            Derivatives
  JOURNAL   J. Biol. Chem. 278 (51), 51307-51315 (2003)
  PUBMED    14534317
REFERENCE   2  (bases 1 to 5406)
  AUTHORS   Sandu C, Chiribau CB, Sachelaru P, Brandsch R.
  TITLE     Plasmids for nicotine-dependent and -independent gene expression in 
            Arthrobacter nicotinovorans and other arthrobacter species
  JOURNAL   Appl. Environ. Microbiol. 71 (12), 8920-8924 (2005)
  PUBMED    16332890
REFERENCE   3  (bases 1 to 5406)
  AUTHORS   Sandu C, Brandsch R.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-SEP-2005) Molecular Biophysics, The Rockefeller 
            University, 1230 York Ave, Box 42, New York, NY 10021, USA
REFERENCE   4  (bases 1 to 5406)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 5406)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. Biol. 
            Chem."; date: "2003"; volume: "278"; issue: "51"; pages: 
            "51307-51315"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol."; date: "2005"; volume: "71"; issue: "12"; 
            pages: "8920-8924"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (01-SEP-2005) Molecular Biophysics, The Rockefeller University, 1230
            York Ave, Box 42, New York, NY 10021, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5406
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      6..177
                     /note="PhdnO promoter from Arthrobacter nicotinovorans
                     pAO1"
                     /regulatory_class="promoter"
     repeat_region   10..33
                     /label=operator 2 (IR2)
                     /note="operator 2 (IR2)"
     repeat_region   84..120
                     /label=operator 1 (IR1)
                     /note="operator 1 (IR1)"
     regulatory      88..93
                     /regulatory_class="minus_35_signal"
     regulatory      110..116
                     /regulatory_class="minus_10_signal"
     misc_feature    176..178
                     /label=translation start codon
                     /note="translation start codon"
     misc_feature    178..231
                     /label=multiple cloning site
                     /note="multiple cloning site"
     CDS             232..255
                     /label=8xHis
                     /note="8xHis affinity tag"
     misc_feature    256..258
                     /label=translation stop codon
                     /note="translation stop codon"
     polyA_signal    410..465
                     /label=beta-globin poly(A) signal
                     /note="rabbit beta-globin polyadenylation signal (Gil and 
                     Proudfoot, 1987)"
     rep_origin      complement(538..1126)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             1547..2359
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     CDS             2893..3477
                     /codon_start=1
                     /gene="hnoR"
                     /product="HnoR"
                     /label=hnoR
                     /note="repressor of the 6-D-hydroxy-nicotine oxidase"
                     /protein_id="ABA41004.1"
                     /translation="MRISTVDRRQQLIDAAIRVIRRDGVESASLRTIASEAKASLAAVH
                     VCFTNKDELMQAAAAELLQQLVRSIPRVVDGSEDVRAIAHRVMDLFWAQMVSDELNILA
                     QFEIGIWAKRNPHHGDLSRTVYSDYEKEISKLLVAAAKRQKQTIAARNVARALIVIMDG
                     CSLQYFADPSDPRHKDLCDNLVDAYLDRVGL"
     gene            2893..3477
                     /gene="hnoR"
                     /label=hnoR
     rep_origin      3500..5406
                     /note="pCG100 origin of replication region from
                     Corynebacterium glutamicum"