pAP20 vector (V009487)

LOCUS       40924_4584        6010 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Broad host range vector pAP20, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6010)
  AUTHORS   Law RJ, Hamlin JN, Sivro A, McCorrister SJ, Cardama GA, Cardona ST.
  TITLE     A functional phenylacetic acid catabolic pathway is required for 
            full pathogenicity of Burkholderia cenocepacia in the Caenorhabditis
            elegans host model
  JOURNAL   J. Bacteriol. 190 (21), 7209-7218 (2008)
  PUBMED    18776009
REFERENCE   2  (bases 1 to 6010)
  AUTHORS   Law RJ, Hamlin JNR., Sivro A, McCorrister SJ, Cardama G, Cardona ST.
  TITLE     Direct Submission
  JOURNAL   Submitted (02-APR-2008) Microbiology, University of Manitoba, 45 
            Chancellors Circle, 418 Buller Bldg, Winnipeg, Manitoba R3T 2N2, 
            Canada
REFERENCE   3  (bases 1 to 6010)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6010)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "J. 
            Bacteriol."; date: "2008"; volume: "190"; issue: "21"; pages: 
            "7209-7218"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (02-APR-2008) Microbiology, University of Manitoba, 45 Chancellors 
            Circle, 418 Buller Bldg, Winnipeg, Manitoba R3T 2N2, Canada"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..6010
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        157..185
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     terminator      784..870
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     terminator      962..989
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     promoter        complement(1717..1807)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      3200..3969
                     /label=pBBR1 oriV
                     /note="replication origin of the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica; requires the pBBR1 
                     Rep protein for replication"
     CDS             3970..4629
                     /codon_start=1
                     /label=pBBR1 Rep
                     /note="replication protein for the broad-host-range plasmid
                     pBBR1 from Bordetella bronchiseptica"
                     /translation="MATQSREIGIQAKNKPGHWVQTERKAHEAWAGLIARKPTAAMLLH
                     HLVAQMGHQNAVVVSQKTLSKLIGRSLRTVQYAVKDLVAERWISVVKLNGPGTVSAYVV
                     NDRVAWGQPRDQLRLSVFSAAVVVDHDDQDESLLGHGDLRRIPTLYPGEQQLPTGPGEE
                     PPSQPGIPGMEPDLPALTETEEWERRGQQRLPMPDEPCFLDDGEPLEPPTRVTLPRR"
     CDS             complement(5115..5753)
                     /codon_start=1
                     /gene="CAT"
                     /product="chloramphenicol acetyltransferase"
                     /label=CAT
                     /note="chloramphenicol resistance"
                     /protein_id="ACF35273.1"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRCLMNTTVLR"
     gene            complement(5115..5753)
                     /gene="CAT"
                     /label=CAT
     promoter        complement(5754..5856)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"