Basic Vector Information
- Vector Name:
- pAJM.969
- Antibiotic Resistance:
- Kanamycin
- Length:
- 4558 bp
- Type:
- Cloning vector
- Replication origin:
- p15A ori
- Source/Author:
- Meyer AJ, Segall-Shapiro TH, Voigt CA.
pAJM.969 vector Map
pAJM.969 vector Sequence
LOCUS V009539 4558 bp DNA circular SYN 17-DEC-2018
DEFINITION Exported.
ACCESSION V009539
VERSION V009539
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 4558)
AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA.
TITLE Marionette: E. coli containing 12 highly-optimized small molecule
sensors
JOURNAL bioRxivorg 285866, 1-26 (2018)
REFERENCE 2 (bases 1 to 4558)
AUTHORS Meyer AJ, Segall-Shapiro TH, Voigt CA.
TITLE Direct Submission
JOURNAL Submitted (21-MAR-2018) Synthetic Biology Center, Department of
Biological Engineering, Massachusetts Institute of Technology, 77
Massachusetts Avenue, Cambridge, MA 02139, USA
REFERENCE 3 (bases 1 to 4558)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4558)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "bioRxivorg
285866, 1-26 (2018)"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(21-MAR-2018) Synthetic Biology Center, Department of Biological
Engineering, Massachusetts Institute of Technology, 77 Massachusetts
Avenue, Cambridge, MA 02139, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4558
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 1..53
/label="L3S3P21"
/note="L3S3P21"
/regulatory_class="terminator"
regulatory 73..124
/label="PMph"
/note="PMph"
/regulatory_class="promoter"
misc_feature 74..108
/label="MphO operator"
/note="MphO operator"
regulatory 76..81
/regulatory_class="minus_35_signal"
regulatory 99..104
/regulatory_class="minus_10_signal"
regulatory 111
/label="+1"
/note="+1"
/regulatory_class="other"
misc_RNA 126..176
/label="sTRSV HHRz"
/note="hammerhead ribozyme from the tobacco ringspot virus
satellite RNA (Khvorova et al., 2003)"
regulatory 208..219
/label="B0064"
/note="B0064"
/regulatory_class="ribosome_binding_site"
CDS 226..942
/label="EYFP"
/note="enhanced YFP"
regulatory 946..1006
/label="L3S2P21"
/note="L3S2P21"
/regulatory_class="terminator"
regulatory 1011..1064
/label="PLacIQ"
/note="PLacIQ"
/regulatory_class="promoter"
regulatory 1029..1034
/regulatory_class="minus_35_signal"
regulatory 1052..1057
/regulatory_class="minus_10_signal"
regulatory 1065..1092
/label="mph2"
/note="mph2"
/regulatory_class="ribosome_binding_site"
CDS 1093..1677
/codon_start=1
/product="MphR-AM"
/label="MphR-AM"
/protein_id="AYJ72267.1"
/translation="MPRPKLKSDDEVLEAATVVLKRCGPIEFTLSGVAKEVGLSRAALI
QRFTNRDTLLVRMMERGVEQVRHYLNAIPIGAGPQGLWEFLQVLVRSMDTRNDFSVNYL
ISWYELQVPELRTLAIQRNRAVVEGIRKRLPPGAPAAAELLLHSVIAGATMQWAVDPDG
ELADHVLAQIAAILCLMFPEHDDFQLLQAHA"
regulatory 1678..1698
/label="ery1"
/note="ery1"
/regulatory_class="ribosome_binding_site"
CDS 1699..2430
/gene="ermC"
/label="rRNA adenine N-6-methyltransferase"
/note="rRNA adenine N-6-methyltransferase from
Staphylococcus aureus. Accession#: P02979"
regulatory 2443..2697
/label="induction operon terminator region"
/note="induction operon terminator region"
/regulatory_class="terminator"
rep_origin complement(3009..3554)
/direction=LEFT
/label="p15A ori"
/note="Plasmids containing the medium-copy-number p15A
origin of replication can be propagated in E. coli cells
that contain a second plasmid with the ColE1 origin."
CDS complement(3646..4458)
/label="KanR"
/note="aminoglycoside phosphotransferase"
This page is informational only.