Basic Vector Information
- Vector Name:
- pCD-RAsl1
- Antibiotic Resistance:
- Streptomycin
- Length:
- 5766 bp
- Type:
- Suicide vector
- Replication origin:
- ori
- Source/Author:
- Derntl C, Kiesenhofer DP, Mach RL, Mach-Aigner AR.
pCD-RAsl1 vector Map
pCD-RAsl1 vector Sequence
LOCUS 40924_9346 5766 bp DNA circular SYN 17-DEC-2018
DEFINITION Suicide vector pCD-RAsl1, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5766)
AUTHORS Derntl C, Kiesenhofer DP, Mach RL, Mach-Aigner AR.
TITLE Novel strategies for genomic manipulation of Trichoderma reesei with
the purpose of strain engineering
JOURNAL Appl. Environ. Microbiol. (2015) In press
PUBMED 26150462
REFERENCE 2 (bases 1 to 5766)
AUTHORS Derntl C, Kiesenhofer DP, Mach RL, Mach-Aigner AR.
TITLE Direct Submission
JOURNAL Submitted (15-JUN-2015) Institute of Chemical Engineering, TU Wien,
Gumpendorfer Strasse 1a, Wien 1060, Austria
REFERENCE 3 (bases 1 to 5766)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5766)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol. (2015) In press"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(15-JUN-2015) Institute of Chemical Engineering, TU Wien,
Gumpendorfer Strasse 1a, Wien 1060, Austria"
COMMENT SGRef: number: 3; type: "Journal Article"
COMMENT ##Assembly-Data-START##
Sequencing Technology :: Sanger dideoxy sequencing
##Assembly-Data-END##
FEATURES Location/Qualifiers
source 1..5766
/mol_type="other DNA"
/organism="synthetic DNA construct"
primer_bind 293..309
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 320..338
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
rep_origin complement(3866..4454)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(4631..5419)
/codon_start=1
/label=SmR
/note="aminoglycoside adenylyltransferase (Murphy, 1985)"
/translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
promoter complement(5639..5743)
/label=AmpR promoter
This page is informational only.