Basic Vector Information
- Vector Name:
- pCASP
- Antibiotic Resistance:
- Chloramphenicol
- Length:
- 3048 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Widmaier DM, Voigt CA.
pCASP vector Map
pCASP vector Sequence
LOCUS 40924_9056 3048 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pCASP, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3048)
AUTHORS Widmaier DM, Voigt CA.
TITLE Secreting Spider Silk in Salmonella
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 3048)
AUTHORS Widmaier DM, Voigt CA.
TITLE Direct Submission
JOURNAL Submitted (12-DEC-2006) Pharmaceutical Chemistry, UCSF, 1700 4th
Street, San Francisco, CA 94158, USA
REFERENCE 3 (bases 1 to 3048)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 3048)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(12-DEC-2006) Pharmaceutical Chemistry, UCSF, 1700 4th Street, San
Francisco, CA 94158, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3048
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory 7..170
/note="sicA promoter; psicA"
/regulatory_class="promoter"
CDS 171..563
/codon_start=1
/gene="SicP"
/product="SicP"
/label=SicP
/note="secretion chaperone"
/protein_id="ABN48557.1"
/translation="MQAHQDIIANIGEKLGLPLTFDDNNQCLLLLDSDIFTSIEAKDDI
WLLNGMIIPLSPVCGDSIWRQIMVINGELAANNEGTLAYIDAAETLLLIHAITDLTNTY
HIISQLESFVNQQEALKNILQEYAKV"
gene 171..563
/gene="SicP"
/label=SicP
CDS 1054..1074
/label=TEV site
/note="tobacco etch virus (TEV) protease recognition and
cleavage site"
terminator 1146..1232
/label=rrnB T1 terminator
/note="transcription terminator T1 from the E. coli rrnB
gene"
rep_origin complement(1397..1985)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
terminator complement(2073..2167)
/label=lambda t0 terminator
/note="transcription terminator from phage lambda"
CDS complement(2191..2847)
/label=CmR
/note="chloramphenicol acetyltransferase"
promoter complement(2848..2950)
/label=cat promoter
/note="promoter of the E. coli cat gene encoding
chloramphenicol acetyltransferase"
This page is informational only.