pCaPVX440 vector (V008725)

LOCUS       V008725                14054 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V008725
VERSION     V008725
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 14054)
  AUTHORS   Wang Y, Cong QQ, Lan YF, Geng C, Li XD, Liang YC, Yang ZY, Zhu XP,
            Li XD.
  TITLE     Development of new potato virus X-based vectors for gene
            over-expression and gene silencing assay
  JOURNAL   Virus Res. 191, 62-69 (2014)
   PUBMED   25076104
REFERENCE   2  (bases 1 to 14054)
  AUTHORS   Wang Y, Cong QQ, Li XD.
  TITLE     Direct Submission
  JOURNAL   Submitted (10-APR-2014) Department of Plant Pathology, Shandong
            Agricultural University, No. 61 Daizong street, Tai'an, Shandong
            Province 271018, PR China
REFERENCE   3  (bases 1 to 14054)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 14054)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Virus Res.
            191, 62-69 (2014)"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (10-APR-2014) Department of Plant Pathology, Shandong Agricultural
            University, No. 61 Daizong street, Tai'an, Shandong Province 271018,
            PR China"
            SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..14054
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     5'UTR           1..84
                     /label="derived from PVX isolate 1985"
                     /note="derived from PVX isolate 1985"
     CDS             85..4452
                     /note="RNA replication protein from Potato virus X.
                     Accession#: P09395"
                     /label="RNA replication protein"
     CDS             4486..5163
                     /note="Movement and silencing protein TGBp1 from Potato
                     virus X (strain X3). Accession#: P17780"
                     /label="Movement and silencing protein TGBp1"
     CDS             5147..5494
                     /codon_start=1
                     /gene="TGB2"
                     /product="triple gene block protein 2"
                     /label="TGB2"
                     /protein_id="AII77187.1"
                     /translation="MSAQGHRLTAPVNSEKVYIVLGLSFALVSITFLLSRSNLPHVGDN
                     IHSLPHGGAYRDGTKAILYNSPNLGSRVSLHNGKNAAFAAVLLLTLLIYGSKYISQRNH
                     TCACGNNHSSH"
     gene            5147..5494
                     /gene="TGB2"
                     /label="TGB2"
                     /note="derived from PVX isolate 1985"
     CDS             5427..5639
                     /codon_start=1
                     /gene="TGB3"
                     /product="triple gene block protein 3"
                     /label="TGB3"
                     /protein_id="AII77189.1"
                     /translation="MEVNTYLNAIILVLVVTIIAVISTSLVRTEPCVIKITGESITVLA
                     CKLDAETIRAIADLKPLSVERLSFH"
     gene            5427..5639
                     /gene="TGB3"
                     /label="TGB3"
                     /note="derived from PVX isolate 1985"
     RBS             5496..5504
                     /label="Shine-Dalgarno sequence"
                     /note="full consensus sequence for ribosome-binding sites
                     upstream of start codons in E. coli; complementary to a
                     region in the 3' end of the 16S rRNA (Chen et al., 1994)"
     misc_feature    5668..5691
                     /label="cloning site"
                     /note="cloning site"
     regulatory      5692..5902
                     /note="derived from tobacco mosaic virus coat protein
                     subgenomic promoter"
                     /regulatory_class="promoter"
     misc_feature    5903..5932
                     /label="multiple cloning site"
                     /note="multiple cloning site"
     regulatory      5933..6014
                     /label="derived from PVX isolate 1985"
                     /note="derived from PVX isolate 1985"
                     /regulatory_class="promoter"
     CDS             5997..6710
                     /codon_start=1
                     /gene="cp"
                     /product="coat protein"
                     /label="cp"
                     /protein_id="AII77190.1"
                     /translation="MSSSASTTQATGSTTSTTTKTAGATPATASGLFTIPDGDFFSTAR
                     AIVASNAVATNEDLSKIEAIWKDMKVPTDTMAQAAWDLVRHCADVGSSAQTEMIDTGPY
                     SNGISRARLAAAIKEVCTLRQFCMKYAPVVWNWMLTNNSPPANWQAQGFKPEHKFAAFD
                     FFNGVTNPAAIMPKEGLIRPPSEAEMNAAQTAAFVKITKARAQSNDFASLDAAVTRGRI
                     TGTTTAEAVVTLPPP"
     gene            5997..6710
                     /gene="cp"
                     /label="cp"
                     /note="derived from PVX isolate 1985"
     3'UTR           6711..6811
                     /label="derived from PVX isolate 1985"
                     /note="derived from PVX isolate 1985"
     CDS             6868..6885
                     /label="6xHis"
                     /note="6xHis affinity tag"
     terminator      6920..7172
                     /label="NOS terminator"
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    7194..7218
                     /label="RB T-DNA repeat"
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             8518..9144
                     /label="pVS1 StaA"
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             9581..10645
                     /label="pVS1 RepA"
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      10714..10908
                     /label="pVS1 oriV"
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    11252..11392
                     /label="bom"
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(11578..12166)
                     /direction=LEFT
                     /label="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
     CDS             complement(12256..13047)
                     /label="KanR"
                     /note="aminoglycoside phosphotransferase"
     misc_feature    13472..13496
                     /label="LB T-DNA repeat"
                     /note="left border repeat from nopaline C58 T-DNA"
     promoter        13711..14054
                     /label="CaMV 35S promoter"
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"