pCAMBIA2301 vector (Cat. No.: V008744)

pCAMBIA230111633 bp50010001500200025003000350040004500500055006000650070007500800085009000950010000105001100011500synthetic first gus exon (modular)GUS6xHisNOS terminatorRB T-DNA repeatpVS1 StaApVS1 RepApVS1 oriVbomoriKanRLB T-DNA repeatCaMV poly(A) signalNeoR/KanRCaMV 35S promoter (enhanced)CAP binding sitelac promoterlac operatorM13 revMCSM13 fwdCaMV 35S promoter
Basic Information

Note: The pCAMBIA2301 is a classic agrobacterium binary vector for plant transformation, with kanamycin-resistance and GUS genes.

Name:
pCAMBIA2301
Antibiotic Resistance:
Kanamycin
Length:
11633 bp
Type:
Binary vector
Replication origin:
ori
Host:
Plants
Source/Author:
Hajdukiewicz P, Svab Z, Maliga P.
Promoter:
CaMV35S(short)
Growth Strain(s):
JM108
Growth Temperature:
37℃
$ 199.1
In stock, instant shipping
Buy one, get one free! (?)
Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add sterile water to dissolve the DNA: add 20 μl for 5 μg plasmid, and 100 μl for 100 μg plasmid.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

References

  • Ivanova LA, Komakhin RA. Efficiency of the alpha-hairpinin SmAMP-X gene promoter from Stellaria media plant depends on selection of transgenic approach. Transgenic Res. Published online December 10, 2023. doi:10.1007/s11248-023-00374-6

pCAMBIA2301 vector (Cat. No.: V008744) Sequence

LOCUS       pCAMBIA-2301       11633 bp DNA     circular SYN 20-JUL-2025
DEFINITION  Binary vector pCAMBIA-2301, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 11633)
  AUTHORS   Hajdukiewicz P, Svab Z, Maliga P.
  TITLE     The small, versatile pPZP family of Agrobacterium binary vectors for
            plant transformation
  JOURNAL   Plant Mol. Biol. 25 (6), 989-994 (1994)
  PUBMED    7919218
REFERENCE   2  (bases 1 to 11633)
  AUTHORS   Roberts C, Rajagopal S, Smith LM, Nguyen TA, Yang W, Nugrohu S, Ravi
            KS, Vijayachandra K, Harcourt RL, Dransfield L, Desamero N, Slamet 
            I, Hadjukiewicz P, Svab Z, Maliga P, Mayer JE, Keese PK, Kilian A, 
            Jefferson RA.
  TITLE     A comprehensive set of modular vectors for advanced manipulations 
            and efficient transformation of plants
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 11633)
  AUTHORS   Roberts C, Rajagopal S, Smith LM, Nguyen TA, Yang W, Nugrohu S, Ravi
            KS, Vijayachandra K, Harcourt RL, Dransfield L, Desamero N, Slamet 
            I, Hadjukiewicz P, Svab Z, Maliga P, Mayer JE, Keese PK, Kilian A, 
            Jefferson RA.
  TITLE     Direct Submission
  JOURNAL   Submitted (15-FEB-2000) CAMBIA, Clunies Ross St, Black Mountain / 
            GPO Box 3200, Canberra, ACT 2601, Australia
REFERENCE   4  (bases 1 to 11633)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 11633)
  TITLE     Direct Submission
REFERENCE   6  (bases 1 to 11633)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Plant Mol.
            Biol."; date: "1994"; volume: "25"; issue: "6"; pages: "989-994"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (15-FEB-2000) CAMBIA, Clunies Ross St, Black Mountain / GPO Box
            3200, Canberra, ACT 2601, Australia"
COMMENT     SGRef: number: 4; type: "Journal Article"
COMMENT     SGRef: number: 5; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..11633
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     exon            2..16
                     /note="synthetic first gus exon (modular)"
     intron          17..206
                     /label=cat1 intron
                     /note="castor bean catalase intron, modified"
     CDS             201..2024
                     /codon_start=1
                     /label=GUS
                     /note="beta-glucuronidase"
                     /translation="LQNRRLVRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQ
                     ESRAIAVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFDAVTHYGKVWV
                     NNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVCVNNELNWQTIPPGMVITDENGKKKQ
                     SYFHDFFNYAGIHRSVMLYTTPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELR
                     DADQQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIYPLRVGIRSVAV
                     KGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLMVHDHALMDWIGANSYRTSHYPYAE
                     EMLDWADEHGIVVIDETAAVGFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKE
                     LIARDKNHPSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVMFCDAHT
                     DTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQEKLHQPIIITEYGVDTLAG
                     LHSMYTDMWSEEYQCAWLDMYHRVFDRVSAVVGEQVWNFADFATSQGILRVGGNKKGIF
                     TRDRKPKSAAFLLQKRWTGMNFGEKPQQGGKQ"
     CDS             2031..2048
                     /label=6xHis
                     /note="6xHis affinity tag"
     terminator      2083..2335
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    2357..2381
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     CDS             3682..4308
                     /label=pVS1 StaA
                     /note="stability protein from the Pseudomonas plasmid pVS1
                     (Heeb et al., 2000)"
     CDS             4746..5810
                     /label=pVS1 RepA
                     /note="replication protein from the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     rep_origin      5879..6073
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid
                     pVS1 (Heeb et al., 2000)"
     misc_feature    6417..6557
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(6743..7331)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7421..8212)
                     /label=KanR
                     /note="aminoglycoside phosphotransferase"
     misc_feature    8637..8661
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     polyA_signal    complement(8739..8913)
                     /label=CaMV poly(A) signal
                     /note="cauliflower mosaic virus polyadenylation signal"
     CDS             complement(8973..9761)
                     /label=NeoR/KanR
                     /note="aminoglycoside phosphotransferase"
     promoter        complement(9830..10506)
                     /label=CaMV 35S promoter (enhanced)
                     /note="cauliflower mosaic virus 35S promoter with a
                     duplicated enhancer region"
     protein_bind    10697..10718
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        10733..10763
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    10771..10787
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     10795..10811
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    10820..10876
                     /label=MCS
                     /note="pUC18/19 multiple cloning site"
     primer_bind     complement(10880..10896)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        11273..11618
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"