Basic Vector Information
- Vector Name:
- pCAGGS-FLAGmA20f8
- Antibiotic Resistance:
- Ampicillin
- Length:
- 5332 bp
- Type:
- Mammalian expression vector
- Replication origin:
- ori
- Source/Author:
- De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman Fonseca M, Vanhoucke M, Beyaert R.
- Promoter:
- CAG
pCAGGS-FLAGmA20f8 vector Map
pCAGGS-FLAGmA20f8 vector Sequence
LOCUS 40924_8401 5332 bp DNA circular SYN 17-DEC-2018
DEFINITION Mammalian expression vector pCAGGS-FLAGmA20f8, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 5332)
AUTHORS De Schamphelaire W, Olbrechts A, Meert J, Verhelst K, Roggeman
Fonseca M, Vanhoucke M, Beyaert R.
TITLE BCCM/LMBP Plasmid collection
JOURNAL Unpublished
REFERENCE 2 (bases 1 to 5332)
AUTHORS De Schamphelaire W.
TITLE Direct Submission
JOURNAL Submitted (02-FEB-2017) BCCM/LMBP, Universiteit Gent,
Technologiepark 927, 9052, BELGIUM
REFERENCE 3 (bases 1 to 5332)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 5332)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName:
"Unpublished"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(02-FEB-2017) BCCM/LMBP, Universiteit Gent, Technologiepark 927,
9052, BELGIUM"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..5332
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS 13..36
/label=FLAG
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
CDS 49..606
/codon_start=1
/note="unnamed protein product; mA20 (591-775)"
/protein_id="SJL88084.1"
/translation="KCRKAGCMYFGTPENKGFCTLCFIEYRENKQSVTASAKAGSPAPR
FQNNVPCLGRECGTLGSTMFEGYCQKCFIEAQNQRFHEARRTEEQLRSSQHRDMPRTTQ
VASRPKCARASCKNILACRSEELCMECQHLSQRVGSVAHRGEPTPEEPPKQRCRAPACD
HFGNAKCNGYCNECYQFKQMYG"
polyA_signal 685..740
/label=beta-globin poly(A) signal
/note="rabbit beta-globin polyadenylation signal (Gil and
Proudfoot, 1987)"
primer_bind complement(1101..1117)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(1125..1141)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1149..1179)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(1193..1214)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 1272..1468
/label=SV40 promoter
/note="SV40 early promoter"
polyA_signal 1474..1608
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
rep_origin complement(1846..2434)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2608..3465)
/label=AmpR
/note="beta-lactamase"
promoter complement(3466..3570)
/label=AmpR promoter
enhancer 3605..3984
/label=CMV enhancer
/note="human cytomegalovirus immediate early enhancer"
regulatory 3605..3982
/label=hCMV-IE enhancer
/note="hCMV-IE enhancer"
/regulatory_class="promoter"
promoter 3986..4263
/label=chicken beta-actin promoter
intron 4264..5281
/label=chimeric intron
/note="chimera between introns from chicken beta-actin and
rabbit beta-globin"
This page is informational only.