Cart 2

PC-GW-Hyg vector (V008972#)

Basic Vector Information

Basic Vector Information
Vector Name PC-GW-Hyg Antibiotic Resistance Chloramphenicol
Length 12013 bp Type Binary vector
Source Dalal J, Yalamanchili R, La Hovary C, Ji M, Rodriguez-Welsh M, Aslett D, Ganapathy S, Grunden A, Sederoff H, Qu R.

PC-GW-Hyg vector Vector Map

PC-GW M13 fwd RB T-DNA repeat pVS1 StaA pVS1 RepA pVS1 oriV bom ori aadA left border T-DNA repeat CaMV poly(A) signal HPTII CamV 35S2 promoter CAP binding site lac promoter lac operator M13 rev

PC-GW-Hyg vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               12013 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Binary vector PC-GW-Hyg, complete sequence.
ACCESSION   KP826770
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 12013)
  AUTHORS   Dalal J, Yalamanchili R, La Hovary C, Ji M, Rodriguez-Welsh M, 
            Aslett D, Ganapathy S, Grunden A, Sederoff H, Qu R.
  TITLE     A novel gateway-compatible binary vector series (PC-GW) for flexible
            cloning of multiple genes for genetic transformation of plants
  JOURNAL   Plasmid 81, 55-62 (2015)
  PUBMED    26188330
REFERENCE   2  (bases 1 to 12013)
  AUTHORS   Dalal J, Yalamanchili R, Hovary CL, Ji M, Rodriguez-Welsh M, Aslett 
            D, Ganapathy S, Grunden A, Sederoff H, Qu R.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-FEB-2015) Crop Science, North Carolina State 
            University, Campus Box 7287, Raleigh, NC 27695, USA
REFERENCE   3  (bases 1 to 12013)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..12013
                     /organism="Binary vector PC-GW-Hyg"
                     /mol_type="other DNA"
                     /db_xref="taxon:1642503"
     misc_feature    7..3106
                     /label=PC-GW
                     /note="PC-GW"
     regulatory      121..956
                     /regulatory_class="promoter"
                     /note="35S promoter from PUGW5 cloning vector"
     promoter        608..953
                     /label=CaMV 35S promoter
                     /note="strong constitutive promoter from cauliflower mosaic
                     virus"
     misc_feature    979..2777
                     /label=Gateway region from pEarleyGate100
                     /note="Gateway region from pEarleyGate100"
     misc_recomb     979..1161
                     /label=attR1 recombination site from pEarleyGate100
                     /note="attR1 recombination site from pEarleyGate100"
     protein_bind    1042..1166
                     /gene="mutant version of attR"
                     /label=attR1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        1191..1221
                     /label=lac UV5 promoter
                     /note="E. coli lac promoter with an ""up"" mutation"
     CDS             1275..1934
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=CmR
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPVSRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     CDS             2276..2581
                     /codon_start=1
                     /gene="ccdB"
                     /product="CcdB"
                     /label=ccdB
                     /protein_id="AKC88575.1"
                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK
                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"
     gene            2276..2581
                     /gene="ccdB"
                     /label=ccdB
     misc_recomb     2653..2777
                     /label=attR2 recombination site from pEarleyGate100
                     /note="attR2 recombination site from pEarleyGate100"
     protein_bind    complement(2653..2777)
                     /gene="mutant version of attR"
                     /label=attR2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     regulatory      2881..3106
                     /regulatory_class="terminator"
                     /note="35S terminator from pSIM1 cloning vector"
     primer_bind     complement(3116..3132)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    3335..3359
                     /label=RB T-DNA repeat
                     /note="right border repeat from nopaline C58 T-DNA"
     misc_feature    3354..3379
                     /label=right border T-DNA repeat from pCAMBIA 2300
                     /note="right border T-DNA repeat from pCAMBIA 2300"
     CDS             4659..5288
                     /codon_start=1
                     /product="stability protein from the Pseudomonas plasmid 
                     pVS1 (Heeb et al., 2000)"
                     /label=pVS1 StaA
                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR
                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP
                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI
                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"
     CDS             5722..6789
                     /codon_start=1
                     /product="replication protein from the Pseudomonas plasmid 
                     pVS1 (Heeb et al., 2000)"
                     /label=pVS1 RepA
                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA
                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR
                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR
                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL
                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA
                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV
                     MRYRNLIEGEASAGS"
     rep_origin      6855..7049
                     /label=pVS1 oriV
                     /note="origin of replication for the Pseudomonas plasmid 
                     pVS1 (Heeb et al., 2000)"
     misc_feature    7393..7533
                     /label=bom
                     /note="basis of mobility region from pBR322"
     rep_origin      complement(7719..8307)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(8394..9188)
                     /codon_start=1
                     /gene="aadA"
                     /product="kanamycin resistance protein"
                     /label=aadA
                     /note="AadA"
                     /protein_id="AKC88573.1"
                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM
                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED
                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT
                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA
                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"
     gene            complement(8394..9188)
                     /gene="aadA"
                     /label=aadA
     misc_feature    9613..9638
                     /label=left border T-DNA repeat
                     /note="left border T-DNA repeat"
     misc_feature    9613..9637
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA"
     polyA_signal    9715..9889
                     /label=CaMV poly(A) signal
                     /note="cauliflower mosaic virus polyadenylation signal"
     CDS             complement(9929..10954)
                     /codon_start=1
                     /gene="HPTII"
                     /product="hygromycin phosphotransferase protein"
                     /label=HPTII
                     /protein_id="AKC88574.1"
                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG
                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP
                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ
                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF
                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG
                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK
                     K"
     gene            complement(9929..10954)
                     /gene="HPTII"
                     /label=HPTII
     regulatory      complement(10990..11770)
                     /regulatory_class="promoter"
                     /note="CamV 35S2 promoter"
     promoter        complement(11022..11699)
                     /label=CaMV 35S promoter (enhanced)
                     /note="cauliflower mosaic virus 35S promoter with a 
                     duplicated enhancer region"
     protein_bind    11890..11911
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     promoter        11926..11956
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    11964..11980
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     11988..12004
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"

This page is informational only.