pc-Cdk1-3Myc-BSR vector (Cat. No.: V008978)
Basic Information
- Name:
- pc-Cdk1-3Myc-BSR
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4663 bp
- Type:
- Giardia integration vector
- Replication origin:
- ori
- Source/Author:
- Gourguechon S, Cande WZ.
pc-Cdk1-3Myc-BSR vector (Cat. No.: V008978) Sequence
LOCUS V008978 4663 bp DNA circular SYN 17-DEC-2018
DEFINITION Exported.
ACCESSION V008978
VERSION V008978
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
.
REFERENCE 1 (bases 1 to 4663)
AUTHORS Gourguechon S, Cande WZ.
TITLE Rapid tagging and integration of genes in Giardia intestinalis
JOURNAL Eukaryotic Cell (2010) In press
PUBMED 21115739
REFERENCE 2 (bases 1 to 4663)
AUTHORS Gourguechon S, Cande WZ.
TITLE Direct Submission
JOURNAL Submitted (08-NOV-2010) Mol and Cell Biology, University of
California, Berkeley, 345 LSA, Berkeley, CA 94720-3200, USA
REFERENCE 3 (bases 1 to 4663)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4663)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Eukaryotic
Cell (2010) In press"
SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(08-NOV-2010) Mol and Cell Biology, University of California,
Berkeley, 345 LSA, Berkeley, CA 94720-3200, USA"
SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4663
/mol_type="other DNA"
/organism="synthetic DNA construct"
rep_origin complement(3..458)
/direction=LEFT
/label="f1 ori"
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
primer_bind 600..616
/label="M13 fwd"
/note="common sequencing primer, one of multiple similar
variants"
promoter 626..644
/label="T7 promoter"
/note="promoter for bacteriophage T7 RNA polymerase"
CDS 653..1498
/codon_start=1
/product="tagged cyclin-dependent kinase 1"
/label="tagged cyclin-dependent kinase 1"
/note="Cdk1"
/protein_id="ADR65092.1"
/translation="ELMSVIHHNHRLHLIFEYAENDLKKYMDKNPDVSMRVIKSFLYQL
INGVNFCHSRRCLHRDLKPQNLLLSVSDASETPVLKIGDFGLARAFGIPIRQFTHEIIT
LWYRPPEILLGSRHYSTSVDIWSIACIWAEMLMKTPLFPGDSEIDQLFKIFEVLGLPDD
TTWPGVTALPDWKQSFPKFRGKTLKRVLGALLDDEGLDLLTAMLEMDPVKRISAKNALE
HPYFSHNDFDPPGVELKRSEEQKLISEEDLLRSEEQKLISEEDLLRSEEQKLISEEDLL
"
misc_feature 1373..1498
/label="3Myc epitope tag"
/note="3Myc epitope tag"
CDS 1379..1408
/codon_start=1
/product="Myc (human c-Myc proto-oncogene) epitope tag"
/label="Myc"
/translation="EQKLISEEDL"
CDS 1421..1450
/codon_start=1
/product="Myc (human c-Myc proto-oncogene) epitope tag"
/label="Myc"
/translation="EQKLISEEDL"
CDS 1463..1492
/codon_start=1
/product="Myc (human c-Myc proto-oncogene) epitope tag"
/label="Myc"
/translation="EQKLISEEDL"
CDS 1908..2327
/gene="bsr"
/label="Blasticidin-S deaminase"
/note="Blasticidin-S deaminase from Bacillus cereus.
Accession#: P33967"
promoter complement(2475..2493)
/label="T3 promoter"
/note="promoter for bacteriophage T3 RNA polymerase"
primer_bind complement(2514..2530)
/label="M13 rev"
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(2538..2554)
/label="lac operator"
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(2562..2592)
/label="lac promoter"
/note="promoter for the E. coli lac operon"
protein_bind complement(2607..2628)
/label="CAP binding site"
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(2916..3504)
/direction=LEFT
/label="ori"
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(3678..4535)
/label="AmpR"
/note="beta-lactamase"
promoter complement(4536..4640)
/label="AmpR promoter"
This page is informational only.