pBursa vector (V008984)

LOCUS       V008984                 7383 bp    DNA     circular SYN 17-DEC-2018
DEFINITION  Exported.
ACCESSION   V008984
VERSION     V008984
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
            .
REFERENCE   1  (bases 1 to 7383)
  AUTHORS   Bae T, Banger AK, Wallace A, Glass EM, Aslund F, Schneewind O,
            Missiakas DM.
  TITLE     Staphylococcus aureus virulence genes identified by bursa aurealis
            mutagenesis and nematode killing
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (33), 12312-12317 (2004)
   PUBMED   15304642
REFERENCE   2  (bases 1 to 7383)
  AUTHORS   Bae T, Aslund F, Missiakas DM, Schneewind O.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-JUL-2004) Molecular Genetics and Cell Biology,
            Committee on Microbiology, University of Chicago, 920 E. 58th St.,
            Chicago, IL 60637, USA
REFERENCE   3  (bases 1 to 7383)
  AUTHORS   Bae T, Aslund F, Missiakas DM, Schneewind O.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-NOV-2004) Molecular Genetics and Cell Biology,
            Committee on Microbiology, University of Chicago, 920 E. 58th St.,
            Chicago, IL 60637, USA
REFERENCE   4  (bases 1 to 7383)
  AUTHORS   Bae T, Aslund F, Missiakas DM, Schneewind O.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-OCT-2005) Molecular Genetics and Cell Biology,
            Committee on Microbiology, University of Chicago, 920 E. 58th St.,
            Chicago, IL 60637, USA
REFERENCE   5  (bases 1 to 7383)
  TITLE     Direct Submission
REFERENCE   6  (bases 1 to 7383)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
            Acad. Sci. U.S.A."; date: "2004"; volume: "101"; issue: "33"; pages:
            "12312-12317"
            SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
            (01-JUL-2004) Molecular Genetics and Cell Biology, Committee on
            Microbiology, University of Chicago, 920 E. 58th St., Chicago, IL
            60637, USA"
            SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
            (04-NOV-2004) Molecular Genetics and Cell Biology, Committee on
            Microbiology, University of Chicago, 920 E. 58th St., Chicago, IL
            60637, USA"
            SGRef: number: 4; type: "Journal Article"; journalName: "Submitted
            (05-OCT-2005) Molecular Genetics and Cell Biology, Committee on
            Microbiology, University of Chicago, 920 E. 58th St., Chicago, IL
            60637, USA"
            SGRef: number: 5; type: "Journal Article"
            On Oct 5, 2005 this sequence version replaced AY672109.2.
FEATURES             Location/Qualifiers
     source          1..7383
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     CDS             841..1008
                     /codon_start=1
                     /product="cop-6"
                     /label="cop-6"
                     /protein_id="ABA61860.1"
                     /translation="MVVDRKEEKKVAVTLRLTTEENEILNRIKEKYNISKSDATGILIK
                     KYAKEEYGAF"
     CDS             1089..1688
                     /codon_start=1
                     /gene="repC"
                     /product="replication protein"
                     /label="repC"
                     /protein_id="AAU04870.1"
                     /translation="MSENVIKETENKKNSRGRNWTFVLYPESAKAEWLEYLKELHIQFV
                     VSPLHDRDTDTEDRMKKEHYHILVMYEGNKSYEQIKIITEELNATIPQIAGSVKGLVRY
                     MLHMDDPNKFKYQKEDMIVYGGVDVDELLKKTTTDRYKLIKEMIEFIDEQGIVEFKSLM
                     DYAMKFKFDDWFPLLCDNSAYVIQEYIKSNRYKSDR"
     gene            1089..1688
                     /gene="repC"
                     /label="repC"
     rep_origin      1219..1418
                     /label="from pE194"
                     /note="from pE194"
     CDS             3034..3681
                     /gene="cat"
                     /label="Chloramphenicol acetyltransferase"
                     /note="Chloramphenicol acetyltransferase from
                     Staphylococcus aureus. Accession#: P00485"
     CDS             complement(4515..5249)
                     /gene="ermB"
                     /label="rRNA adenine N-6-methyltransferase"
                     /note="rRNA adenine N-6-methyltransferase from Enterococcus
                     faecalis (strain ATCC 700802 / V583). Accession#: P20173"
     primer_bind     5805..5821
                     /label="KS primer"
                     /note="common sequencing primer, one of multiple similar
                     variants"
     rep_origin      complement(5958..6346)
                     /direction=LEFT
                     /label="R6K gamma ori"
                     /note="gamma replication origin from E. coli plasmid R6K;
                     requires the R6K initiator protein pi for replication"
     CDS             complement(6577..7290)
                     /label="yeGFP"
                     /note="yeast-enhanced green fluorescent protein"