pBSD-GFP-INT-attP vector (Cat. No.: V009038)
Basic Information
- Name:
- pBSD-GFP-INT-attP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 8184 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Nkrumah LJ, Muhle RA, Moura PA, Ghosh P, Hatfull GF, Jacobs WR Jr., Fidock DA.
pBSD-GFP-INT-attP vector (Cat. No.: V009038) Sequence
LOCUS 40924_7391 8184 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pBSD-GFP-INT-attP, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 8184)
AUTHORS Nkrumah LJ, Muhle RA, Moura PA, Ghosh P, Hatfull GF, Jacobs WR Jr.,
Fidock DA.
TITLE Efficient site-specific integration in Plasmodium falciparum
chromosomes mediated by mycobacteriophage Bxb1 integrase
JOURNAL Nat. Methods 3 (8), 615-621 (2006)
PUBMED 16862136
REFERENCE 2 (bases 1 to 8184)
AUTHORS Nkrumah LJ, Moura PA, Fidock DA.
TITLE Direct Submission
JOURNAL Submitted (25-JUN-2006) Microbiology and Immunology, Albert Einstein
College of Medicine, 1300 Morris Park, Bronx, NY 10461, USA
REFERENCE 3 (bases 1 to 8184)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 8184)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat.
Methods"; date: "2006"; volume: "3"; issue: "8"; pages: "615-621"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(25-JUN-2006) Microbiology and Immunology, Albert Einstein College
of Medicine, 1300 Morris Park, Bronx, NY 10461, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..8184
/mol_type="other DNA"
/organism="synthetic DNA construct"
regulatory complement(37..865)
/label=derived from hsp86 3' UTR
/note="derived from hsp86 3' UTR"
/regulatory_class="terminator"
CDS complement(875..1585)
/label=yeGFP
/note="yeast-enhanced green fluorescent protein"
CDS complement(1592..1615)
/label=FLAG
/note="FLAG(R) epitope tag, followed by an enterokinase
cleavage site"
misc_feature complement(1622..2020)
/gene="bsd-FLAG-gfp"
/label=BSD
/note="BSD"
CDS complement(1622..2020)
/codon_start=1
/gene="Aspergillus terreus BSD"
/product="blasticidin S deaminase"
/label=BSD
/note="confers resistance to blasticidin"
/translation="MHAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFT
GVNVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPG
IKAIVKDSDGQPTAVGIRELLPSGYVWEG"
misc_feature complement(2036..2659)
/label=contains promoter and 5' UTR from calmodulin gene
/note="contains promoter and 5' UTR from calmodulin gene"
misc_feature 2666..3264
/label=contains promoter and 5' UTR from PcDT gene
/note="contains promoter and 5' UTR from PcDT gene"
CDS 4799..4828
/label=Myc
/note="Myc (human c-Myc proto-oncogene) epitope tag"
regulatory 4838..5428
/label=derived from hrp2 3' UTR
/note="derived from hrp2 3' UTR"
/regulatory_class="terminator"
misc_recomb 5447..5496
/label=attP
/note="attP"
promoter complement(5502..5519)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(5526..5542)
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 6016..6120
/label=AmpR promoter
CDS 6121..6978
/label=AmpR
/note="beta-lactamase"
rep_origin 7152..7740
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
protein_bind 8028..8049
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
promoter 8064..8094
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind 8102..8118
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
primer_bind 8126..8142
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
promoter 8160..8178
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.