pBSD-GFP-INT-attP vector (V009038)

LOCUS       40924_7391        8184 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pBSD-GFP-INT-attP, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8184)
  AUTHORS   Nkrumah LJ, Muhle RA, Moura PA, Ghosh P, Hatfull GF, Jacobs WR Jr., 
            Fidock DA.
  TITLE     Efficient site-specific integration in Plasmodium falciparum 
            chromosomes mediated by mycobacteriophage Bxb1 integrase
  JOURNAL   Nat. Methods 3 (8), 615-621 (2006)
  PUBMED    16862136
REFERENCE   2  (bases 1 to 8184)
  AUTHORS   Nkrumah LJ, Moura PA, Fidock DA.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2006) Microbiology and Immunology, Albert Einstein
            College of Medicine, 1300 Morris Park, Bronx, NY 10461, USA
REFERENCE   3  (bases 1 to 8184)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8184)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Nat. 
            Methods"; date: "2006"; volume: "3"; issue: "8"; pages: "615-621"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (25-JUN-2006) Microbiology and Immunology, Albert Einstein College 
            of Medicine, 1300 Morris Park, Bronx, NY 10461, USA"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8184
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     regulatory      complement(37..865)
                     /label=derived from hsp86 3' UTR
                     /note="derived from hsp86 3' UTR"
                     /regulatory_class="terminator"
     CDS             complement(875..1585)
                     /label=yeGFP
                     /note="yeast-enhanced green fluorescent protein"
     CDS             complement(1592..1615)
                     /label=FLAG
                     /note="FLAG(R) epitope tag, followed by an enterokinase
                     cleavage site"
     misc_feature    complement(1622..2020)
                     /gene="bsd-FLAG-gfp"
                     /label=BSD
                     /note="BSD"
     CDS             complement(1622..2020)
                     /codon_start=1
                     /gene="Aspergillus terreus BSD"
                     /product="blasticidin S deaminase"
                     /label=BSD
                     /note="confers resistance to blasticidin"
                     /translation="MHAKPLSQEESTLIERATATINSIPISEDYSVASAALSSDGRIFT
                     GVNVYHFTGGPCAELVVLGTAAAAAAGNLTCIVAIGNENRGILSPCGRCRQVLLDLHPG
                     IKAIVKDSDGQPTAVGIRELLPSGYVWEG"
     misc_feature    complement(2036..2659)
                     /label=contains promoter and 5' UTR from calmodulin gene
                     /note="contains promoter and 5' UTR from calmodulin gene"
     misc_feature    2666..3264
                     /label=contains promoter and 5' UTR from PcDT gene
                     /note="contains promoter and 5' UTR from PcDT gene"
     CDS             4799..4828
                     /label=Myc
                     /note="Myc (human c-Myc proto-oncogene) epitope tag"
     regulatory      4838..5428
                     /label=derived from hrp2 3' UTR
                     /note="derived from hrp2 3' UTR"
                     /regulatory_class="terminator"
     misc_recomb     5447..5496
                     /label=attP
                     /note="attP"
     promoter        complement(5502..5519)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(5526..5542)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        6016..6120
                     /label=AmpR promoter
     CDS             6121..6978
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      7152..7740
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     protein_bind    8028..8049
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     promoter        8064..8094
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    8102..8118
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     primer_bind     8126..8142
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        8160..8178
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"