pBlTAL vector (V009153)

LOCUS       40924_6706        8219 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector pBlTAL, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8219)
  AUTHORS   Anasontzis GE, Stathopoulou PM, Hatzinikolaou DG.
  TITLE     Homologous overexpression of transaldolase in Fusarium oxysporum
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8219)
  AUTHORS   Anasontzis GE, Stathopoulou PM, Hatzinikolaou DG.
  TITLE     Direct Submission
  JOURNAL   Submitted (31-MAR-2011) Laboratory of Microbiology, Sector of 
            Botany, Department of Biology, National and Kapodistrian University 
            of Athens, Zografou Campus, Zografou, Attiki 15784, Greece
REFERENCE   3  (bases 1 to 8219)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 8219)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (31-MAR-2011) Laboratory of Microbiology, Sector of Botany, 
            Department of Biology, National and Kapodistrian University of 
            Athens, Zografou Campus, Zografou, Attiki 15784, Greece"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..8219
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     rep_origin      complement(3..458)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     primer_bind     600..616
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        626..644
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     promoter        673..1029
                     /label=trpC promoter
                     /note="promoter for Aspergillus nidulans trpC"
     CDS             1040..2062
                     /label=HygR
                     /note="aminoglycoside phosphotransferase from E. coli"
     terminator      2235..2793
                     /label=trpC terminator
                     /note="transcription terminator from the Aspergillus
                     nidulans trpC gene"
     primer_bind     3086..3102
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     terminator      complement(3184..3740)
                     /label=trpC terminator
                     /note="transcription terminator from the Aspergillus
                     nidulans trpC gene"
     CDS             complement(join(3745..3978,4042..4425,4484..4767,4925..4936,
                     4996..5014,5237..5275))
                     /codon_start=1
                     /product="transaldolase"
                     /label=transaldolase
                     /note="from Fusarium oxysporum"
                     /protein_id="AEP71396.1"
                     /translation="MSSSLEQLKATGTTVVSDSGDFASIGKYKPQDATTNPSLILAASK
                     KAEYAKLIDVAIDYAKQKGGPIDQQVDDALDRLLVEFGKEILKIIPGKVSTEVDARYSF
                     DTEASVNKALHLIELYGEQGISKDRILIKIAATWEGIKAAEILQRDHGINTNLTLMFSL
                     VQAIGAAEAGAYLISPFVGRILDWFKASTKKEYSKEEDPGVQSVKTIFNYYKKYGYNTI
                     VMGASFRNTGEITELAGCDYLTISPNLLEELLNSNEPVPKKLDASQASSLDIEKKSYIN
                     DEALFRFDFNEDQMAVEKLREGISKFAADAVTLKSILKEKLA"
     regulatory      complement(5284..6004)
                     /label=gpdA promoter from Aspergillus nidulans
                     /note="gpdA promoter from Aspergillus nidulans"
                     /regulatory_class="promoter"
     promoter        complement(6031..6049)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(6070..6086)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(6094..6110)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(6118..6148)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(6163..6184)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(6472..7060)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7234..8091)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(8092..8196)
                     /label=AmpR promoter