pABCa vector (V009624)

LOCUS       40924_3511        6743 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector pABCa, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6743)
  AUTHORS   Doehlemann J, Wagner M.
  TITLE     A family of single copy repABC-type shuttle vectors stably 
            maintained in the alpha-proteobacterium Sinorhizobium meliloti
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 6743)
  AUTHORS   Doehlemann J, Wagner M.
  TITLE     Direct Submission
  JOURNAL   Submitted (24-OCT-2016) LOEWE-Zentrum fuer Synthetische 
            Mikrobiologie, Philipps-Universitaet Marburg, Hans-Meerwein-Strasse,
            Marburg, Hesse 35043, Germany
REFERENCE   3  (bases 1 to 6743)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 6743)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: 
            "Unpublished"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (24-OCT-2016) LOEWE-Zentrum fuer Synthetische Mikrobiologie, 
            Philipps-Universitaet Marburg, Hans-Meerwein-Strasse, Marburg, Hesse
            35043, Germany"
COMMENT     SGRef: number: 3; type: "Journal Article"
COMMENT     ##Assembly-Data-START##
            Sequencing Technology :: Sanger dideoxy sequencing 
            ##Assembly-Data-END##
FEATURES             Location/Qualifiers
     source          1..6743
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..4692
                     /label=oriVSm part (oriV_pMlb)
                     /note="oriVSm part (oriV_pMlb)"
     terminator      4715..4742
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      complement(4880..4907)
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB
                     gene"
     terminator      5044..5130
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     misc_feature    5214..5243
                     /label=MCS
                     /note="MCS"
     rep_origin      5320..5865
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(6140..6670)
                     /codon_start=1
                     /label=GmR
                     /note="gentamycin acetyltransferase"
                     /translation="MLRSSNDVTQQGSRPKTKLGGSSMGIIRTCRLGPDQVKSMRAALD
                     LFGREFGDVATYSQHQPDSDYLGNLLRSKTFIALAAFDQEAVVGALAAYVLPKFEQARS
                     EIYIYDLAVSGEHRRQGIATALINLLKHEANALGAYVIYVQADYGDDPAVALYTKLGIR
                     EEVMHFDIDPSTAT"