Basic Vector Information
- Vector Name:
- pAB707
- Antibiotic Resistance:
- Apramycin
- Length:
- 7406 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Murakami T, Burian J, Yanai K, Bibb MJ, Thompson CJ.
pAB707 vector Map
pAB707 vector Sequence
LOCUS 40924_3361 7406 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector pAB707, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 7406)
AUTHORS Murakami T, Burian J, Yanai K, Bibb MJ, Thompson CJ.
TITLE A system for the targeted amplification of bacterial gene clusters
multiplies antibiotic yield in Streptomyces coelicolor
JOURNAL Proc. Natl. Acad. Sci. U.S.A. 108 (38), 16020-16025 (2011)
PUBMED 21903924
REFERENCE 2 (bases 1 to 7406)
AUTHORS Murakami T, Burian J IV, Yanai K, Bibb MJ, Thompson CJ.
TITLE Direct Submission
JOURNAL Submitted (20-MAY-2011) Microbiology and Immunology, University of
British Columbia, 2350 Health Sciences Mall, Vancouver, BC V6T 1Z3,
Canada
REFERENCE 3 (bases 1 to 7406)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 7406)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Proc. Natl.
Acad. Sci. U.S.A."; date: "2011"; volume: "108"; issue: "38"; pages:
"16020-16025"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(20-MAY-2011) Microbiology and Immunology, University of British
Columbia, 2350 Health Sciences Mall, Vancouver, BC V6T 1Z3, Canada"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..7406
/mol_type="other DNA"
/organism="synthetic DNA construct"
CDS complement(107..127)
/codon_start=1
/label=SV40 NLS
/note="nuclear localization signal of SV40 (simian virus
40) large T antigen"
/translation="PKKKRKV"
misc_feature 173..804
/label=derived from Streptomyces kanamyceticus
/note="derived from Streptomyces kanamyceticus"
misc_recomb 503..527
/label=recombination site RsA
/note="recombination site RsA"
protein_bind 1002..1035
/label=FRT (minimal)
/note="supports FLP-mediated excision but not integration
(Turan and Bode, 2011)"
oriT complement(1042..1151)
/direction=LEFT
/label=oriT
/note="incP origin of transfer"
CDS 1467..2267
/codon_start=1
/label=ApmR
/note="aminoglycoside 3-N-acetyltransferase type IV"
/translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP
LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV
KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH
LAELMAKVPYGVPRHCTILHDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH
AFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG"
protein_bind 2277..2323
/label=FRT
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
misc_recomb complement(2290..2323)
/label=FRT site
/note="FRT site"
misc_feature 2343..4428
/label=derived from Streptomyces kanamyceticus
/note="derived from Streptomyces kanamyceticus"
misc_recomb 4039..4066
/label=recombination site RsB
/note="recombination site RsB"
promoter complement(4712..4730)
/label=T3 promoter
/note="promoter for bacteriophage T3 RNA polymerase"
promoter 4845..4949
/label=AmpR promoter
CDS 4950..5807
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
[TEM beta-lactamase fragment, 59 aa]
LIKHW"
rep_origin 5981..6569
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
polyA_signal complement(6954..7088)
/label=SV40 poly(A) signal
/note="SV40 polyadenylation signal"
This page is informational only.