pA2 vector (V009690) Gene synthesis in pA2 backbone

Price Information

Cat No. Plasmid Name Availability Buy one, get one free! (?)
V009690 pA2 In stock, instant shipping

Two tubes of lyophilized plasmid will be delivered, each tube is about 5µg.

Basic Vector Information

Vector Name:
pA2
Antibiotic Resistance:
Ampicillin
Length:
5143 bp
Type:
Phagemid cloning vector
Replication origin:
ori
Source/Author:
Fagerlund A, Myrset AH, Kulseth MA.
Promoter:
araBAD
Growth Strain(s):
DH10B
Growth Temperature:
37℃

pA2 vector Map

pA25143 bp6001200180024003000360042004800araBAD promotergVIIIM13 oriAmpR promoterAmpRoribomaraC

Plasmid Protocol

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5. Store the plasmid at -20 ℃.

6. The concentration of plasmid re-measurement sometimes differs from the nominal value, which may be due to the position of the lyophilized plasmid in the tube, the efficiency of the re-dissolution, the measurement bias, and adsorption on the wall of the tube, therefore, it is recommended to transform and extract the plasmid before using it

General Plasmid Transform Protocol

1. Take one 100μl of the competent cells and thaw it on ice for 10min, add 2μl of plasmid, then ice bath for 30min, then heat-shock it at 42℃ for 60s, do not stir, and then ice bath for 2min.

2. Add 900μl of LB liquid medium without antibiotics, and incubate at 37℃ for 45min (30℃ for 1-1.5 hours) with 180rpm shaking.

3. Centrifuge at 6000rpm for 5min, leave only 100μl of supernatant to resuspend the bacterial precipitate and spread it onto the target plasmid-resistant LB plate.

4. Invert the plate and incubate at 37℃ for 14h, or at 30℃ for 20h.

5. Pick a single colony into LB liquid medium, add the corresponding antibiotics, incubate at 220rpm for 14h, and extract the plasmid according to the experimental needs and the instructions of the plasmid extraction kit.

pA2 vector Sequence

LOCUS       40924_2987        5143 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Phagemid cloning vector pA2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5143)
  AUTHORS   Fagerlund A, Myrset AH, Kulseth MA.
  TITLE     Construction and characterization of a 9-mer phage display 
            pVIII-library with regulated peptide density
  JOURNAL   Appl. Microbiol. Biotechnol. 80 (5), 925-936 (2008)
  PUBMED    18716770
REFERENCE   2  (bases 1 to 5143)
  AUTHORS   Fagerlund A, Myrset AH, Kulseth MA.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-FEB-2008) GE Healthcare Medical Diagnostics, P.O. Box 
            4220 Nydalen, Oslo N-0401, Norway
REFERENCE   3  (bases 1 to 5143)
  TITLE     Direct Submission
REFERENCE   4  (bases 1 to 5143)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Microbiol. Biotechnol."; date: "2008"; volume: "80"; issue: "5"; 
            pages: "925-936"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: "Submitted 
            (12-FEB-2008) GE Healthcare Medical Diagnostics, P.O. Box 4220 
            Nydalen, Oslo N-0401, Norway"
COMMENT     SGRef: number: 3; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..5143
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     promoter        1..285
                     /label=araBAD promoter
                     /note="promoter of the L-arabinose operon of E. coli; the
                     araC regulatory gene is transcribed in the opposite 
                     direction (Guzman et al., 1995)"
     gene            318..891
                     /gene="gVIII"
                     /label=gVIII
     CDS             318..401
                     /codon_start=1
                     /gene="gVIII"
                     /product="major coat protein pVIII"
                     /label=gVIII
                     /protein_id="ACA60871.1"
                     /translation="MKKSLVLKASVAVATLVPMLSFAAEGEF"
     sig_peptide     318..398
                     /gene="gVIII"
     misc_feature    396..401
                     /gene="gVIII"
                     /label=unique EcoRI cloning site
                     /note="unique EcoRI cloning site"
     misc_feature    402..749
                     /gene="gVIII"
                     /note="spacer fragment; derived from lambda phage"
     misc_feature    750..755
                     /gene="gVIII"
                     /label=unique BglII cloning site
                     /note="unique BglII cloning site"
     CDS             751..891
                     /codon_start=1
                     /gene="gVIII"
                     /product="major coat protein pVIII"
                     /label=gVIII
                     /protein_id="ACA60872.1"
                     /translation="DLAKAAFDSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKA
                     S"
     primer_bind     complement(891..907)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     rep_origin      1348..1861
                     /label=M13 ori
                     /note="M13 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        1925..2029
                     /label=AmpR promoter
     CDS             2030..2887
                     /label=AmpR
                     /note="beta-lactamase"
     rep_origin      3061..3649
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    complement(3835..3975)
                     /label=bom
                     /note="basis of mobility region from pBR322"
     CDS             complement(4242..5117)
                     /label=araC
                     /note="L-arabinose regulatory protein"