Basic Vector Information
- Vector Name:
- p713-909
- Antibiotic Resistance:
- Ampicillin
- Length:
- 4491 bp
- Type:
- Cloning vector
- Replication origin:
- R6K γ ori
- Source/Author:
- Shigaki T, Vyzasatya RR, Sivitz AB, Ward JM, Sze H, Hirschi KD.
p713-909 vector Map
p713-909 vector Sequence
LOCUS 40924_2942 4491 bp DNA circular SYN 17-DEC-2018
DEFINITION Cloning vector p713-909, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 4491)
AUTHORS Shigaki T, Vyzasatya RR, Sivitz AB, Ward JM, Sze H, Hirschi KD.
TITLE The Cre-loxP recombination-based reporter system for plant
transcriptional expression studies
JOURNAL Plant Mol. Biol. 58 (1), 65-73 (2005)
PUBMED 16028117
REFERENCE 2 (bases 1 to 4491)
AUTHORS Shigaki T, Hirschi KD, Ward JM, Sze H.
TITLE Direct Submission
JOURNAL Submitted (03-SEP-2004) Pediatrics, Baylor College of Medicine, Room
9016, CNRC, 1100 Bates St., Houston, TX 77030, USA
REFERENCE 3 (bases 1 to 4491)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 4491)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Plant Mol.
Biol."; date: "2005"; volume: "58"; issue: "1"; pages: "65-73"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(03-SEP-2004) Pediatrics, Baylor College of Medicine, Room 9016,
CNRC, 1100 Bates St., Houston, TX 77030, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..4491
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind complement(7..40)
/label=loxP
/note="Cre-mediated recombination occurs in the 8-bp core
sequence (ATGTATGC) (Shaw et al., 2021)."
CDS 97..807
/codon_start=1
/label=GFP (S65T)
/note="S65T variant of Aequorea victoria green fluorescent
protein (Heim et al., 1995)"
/translation="SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKF
ICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGN
YKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVN
FKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEF
VTAAGITHGMDELYK"
polyA_signal 925..1132
/label=bGH poly(A) signal
/note="bovine growth hormone polyadenylation signal"
terminator 1204..1251
/label=T7 terminator
/note="transcription terminator for bacteriophage T7 RNA
polymerase"
rep_origin complement(1347..1735)
/direction=LEFT
/label=R6K gamma ori
/note="gamma replication origin from E. coli plasmid R6K;
requires the R6K initiator protein pi for replication"
rep_origin complement(1756..2211)
/direction=LEFT
/label=f1 ori
/note="f1 bacteriophage origin of replication; arrow
indicates direction of (+) strand synthesis"
CDS complement(2248..3105)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="[TEM beta-lactamase fragment, 45 aa]
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
[TEM beta-lactamase fragment, 59 aa]
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPFRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
promoter complement(3106..3210)
/label=AmpR promoter
This page is informational only.