Basic Vector Information
- Vector Name:
- p3E-zfRab18a-R93del
- Antibiotic Resistance:
- Kanamycin
- Length:
- 3253 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Nixon SJ, Hall TE, Parton RG.
p3E-zfRab18a-R93del vector Vector Map
Plasmid Resuspension Protocol:
1. Centrifuge at 5,000×g for 5 min.
2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.
5.Store the plasmid at -20 ℃.
p3E-zfRab18a-R93del vector Sequence
LOCUS 40924_2652 3253 bp DNA circular SYN 18-DEC-2018 DEFINITION Cloning vector p3E-zfRab18a-R93del, complete sequence. ACCESSION . VERSION . KEYWORDS . SOURCE synthetic DNA construct ORGANISM synthetic DNA construct REFERENCE 1 (bases 1 to 3253) AUTHORS Nixon SJ, Hall TE, Parton RG. TITLE Rab18 in zebrafish JOURNAL Unpublished REFERENCE 2 (bases 1 to 3253) AUTHORS Hall TE, Parton RG. TITLE Direct Submission JOURNAL Submitted (13-JUN-2014) Institute for Molecular Bioscience, University of Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia REFERENCE 3 (bases 1 to 3253) TITLE Direct Submission REFERENCE 4 (bases 1 to 3253) AUTHORS . TITLE Direct Submission COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Unpublished" COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted (13-JUN-2014) Institute for Molecular Bioscience, University of Queensland, 306 Carmody Road, St Lucia, QLD 4067, Australia" COMMENT SGRef: number: 3; type: "Journal Article" COMMENT ##Assembly-Data-START## Sequencing Technology :: Sanger dideoxy sequencing ##Assembly-Data-END## FEATURES Location/Qualifiers source 1..3253 /mol_type="other DNA" /organism="synthetic DNA construct" terminator complement(268..295) /label=rrnB T2 terminator /note="transcription terminator T2 from the E. coli rrnB gene" terminator complement(387..473) /label=rrnB T1 terminator /note="transcription terminator T1 from the E. coli rrnB gene" primer_bind 537..553 /label=M13 fwd /note="common sequencing primer, one of multiple similar variants" protein_bind complement(624..748) /label=attR2 /note="recombination site for the Gateway(R) LR reaction" CDS 747..1361 /codon_start=1 /product="Rab18a" /label=Rab18a /note="with R93del mutation; derived from zebrafish" /protein_id="AIO08314.1" /translation="MNDDILTTLKILIIGESGVGKSSLLLRFTDDTFDAEIGATIGVDF KVKTLAVDGNRAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVSRETFAKLDNWLSE LETYCTRNDLVKMLVGNKIDKDDREIEREEGLKFARKHSMLFIESSAKTRDGVQCAFEE LVEKILQTPGLWESMHKSRGVALSELSESSQGGCGAYCSLL" protein_bind complement(1362..1457) /label=attL3 /note="recombination site for the Gateway(R) LR reaction" promoter complement(1495..1513) /label=T7 promoter /note="promoter for bacteriophage T7 RNA polymerase" primer_bind complement(1518..1534) /label=M13 rev /note="common sequencing primer, one of multiple similar variants" CDS 1647..2453 /codon_start=1 /label=KanR /note="aminoglycoside phosphotransferase" /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGKTA FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF" rep_origin 2603..3191 /direction=RIGHT /label=ori /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of replication"
This page is informational only.