p34S-Tp2 vector (V009752)

Basic Vector Information

Vector Name:
p34S-Tp2
Antibiotic Resistance:
Ampicillin
Length:
3394 bp
Type:
Cloning vector
Replication origin:
ori
Source/Author:
Dennis JJ, Zylstra GJ.
Promoter:
Pc

p34S-Tp2 vector Vector Map

p34S-Tp23394 bp6001200180024003000multiple cloning site cassettePc promoterTpRmultiple cloning site cassetteT7 promoterM13 revlac operatorlac promoterCAP binding siteoriAmpRAmpR promoterM13 fwdSP6 promoter

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

p34S-Tp2 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       40924_2612        3394 bp DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector p34S-Tp2, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3394)
  AUTHORS   Dennis JJ, Zylstra GJ.
  TITLE     Plasposons: modular self-cloning minitransposon derivatives for 
            rapid genetic analysis of gram-negative bacterial genomes
  JOURNAL   Appl. Environ. Microbiol. 64 (7), 2710-2715 (1998)
  PUBMED    9647854
REFERENCE   2  (bases 1 to 3394)
  AUTHORS   Dennis JJ, Zylstra GJ.
  TITLE     Improved antibiotic-resistance cassettes through restriction site 
            elimination using Pfu DNA polymerase PCR
  JOURNAL   BioTechniques 25 (5), 772-774 (1998)
  PUBMED    9821576
REFERENCE   3  (bases 1 to 3394)
  AUTHORS   Dennis JJ, Zylstra GJ.
  TITLE     Direct Submission
  JOURNAL   Submitted (12-AUG-1998) Biotechnology Center for Agriculture and the
            Environment, Cook College, Rutgers University, 59 Dudley Rd., New 
            Brunswick, NJ 08901, USA
REFERENCE   4  (bases 1 to 3394)
  TITLE     Direct Submission
REFERENCE   5  (bases 1 to 3394)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Appl. 
            Environ. Microbiol."; date: "1998"; volume: "64"; issue: "7"; pages:
            "2710-2715"
COMMENT     SGRef: number: 2; type: "Journal Article"; journalName: 
            "BioTechniques"; date: "1998"; volume: "25"; issue: "5"; pages: 
            "772-774"
COMMENT     SGRef: number: 3; type: "Journal Article"; journalName: "Submitted 
            (12-AUG-1998) Biotechnology Center for Agriculture and the 
            Environment, Cook College, Rutgers University, 59 Dudley Rd., New 
            Brunswick, NJ 08901, USA"
COMMENT     SGRef: number: 4; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..3394
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     misc_feature    1..51
                     /label=multiple cloning site cassette
                     /note="multiple cloning site cassette"
     promoter        64..92
                     /label=Pc promoter
                     /note="class 1 integron promoter"
     misc_difference 374
                     /replace="c"
                     /label=site-directed modification
                     /note="site-directed modification"
     CDS             419..652
                     /codon_start=1
                     /label=TpR
                     /note="E. coli plasmid-associated dihydrofolate reductase"
                     /translation="MGQSSDEANAPVAGQFALPLSATFGLGDRVRKKSGAAWQGQVVGW
                     YCTKLTPEGYAVESESHPGSVQIYPVAALERVA"
     misc_feature    658..708
                     /label=multiple cloning site cassette
                     /note="multiple cloning site cassette"
     promoter        complement(714..732)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(751..767)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(775..791)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(799..829)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(844..865)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(1153..1741)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(1915..2772)
                     /codon_start=1
                     /label=AmpR
                     /note="beta-lactamase"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(2773..2877)
                     /label=AmpR promoter
     primer_bind     3351..3367
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        3370..3388
                     /label=SP6 promoter
                     /note="promoter for bacteriophage SP6 RNA polymerase"

This page is informational only.