Basic Vector Information
- Vector Name:
- p34S-Cm2
- Antibiotic Resistance:
- Ampicillin
- Length:
- 3604 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Dennis JJ, Zylstra GJ.
- Promoter:
- SP6
p34S-Cm2 vector Map
p34S-Cm2 vector Sequence
LOCUS 40924_2577 3604 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector p34S-Cm2, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 3604)
AUTHORS Dennis JJ, Zylstra GJ.
TITLE Plasposons: modular self-cloning minitransposon derivatives for
rapid genetic analysis of gram-negative bacterial genomes
JOURNAL Appl. Environ. Microbiol. 64 (7), 2710-2715 (1998)
PUBMED 9647854
REFERENCE 2 (bases 1 to 3604)
AUTHORS Dennis JJ, Zylstra GJ.
TITLE Improved antibiotic-resistance cassettes through restriction site
elimination using Pfu DNA polymerase PCR
JOURNAL BioTechniques 25 (5), 772-774 (1998)
PUBMED 9821576
REFERENCE 3 (bases 1 to 3604)
AUTHORS Dennis JJ, Zylstra GJ.
TITLE Direct Submission
JOURNAL Submitted (12-AUG-1998) Biotechnology Center for Agriculture and the
Environment, Cook College, Rutgers University, 59 Dudley Rd., New
Brunswick, NJ 08901, USA
REFERENCE 4 (bases 1 to 3604)
TITLE Direct Submission
REFERENCE 5 (bases 1 to 3604)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Appl.
Environ. Microbiol."; date: "1998"; volume: "64"; issue: "7"; pages:
"2710-2715"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName:
"BioTechniques"; date: "1998"; volume: "25"; issue: "5"; pages:
"772-774"
COMMENT SGRef: number: 3; type: "Journal Article"; journalName: "Submitted
(12-AUG-1998) Biotechnology Center for Agriculture and the
Environment, Cook College, Rutgers University, 59 Dudley Rd., New
Brunswick, NJ 08901, USA"
COMMENT SGRef: number: 4; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..3604
/mol_type="other DNA"
/organism="synthetic DNA construct"
misc_feature 1..51
/label=multiple cloning site cassette
/note="multiple cloning site cassette"
CDS 120..776
/codon_start=1
/label=CmR
/note="chloramphenicol acetyltransferase"
/translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
misc_feature 868..918
/label=multiple cloning site cassette
/note="multiple cloning site cassette"
promoter complement(924..942)
/label=T7 promoter
/note="promoter for bacteriophage T7 RNA polymerase"
primer_bind complement(961..977)
/label=M13 rev
/note="common sequencing primer, one of multiple similar
variants"
protein_bind complement(985..1001)
/label=lac operator
/note="The lac repressor binds to the lac operator to
inhibit transcription in E. coli. This inhibition can be
relieved by adding lactose or
isopropyl-beta-D-thiogalactopyranoside (IPTG)."
promoter complement(1009..1039)
/label=lac promoter
/note="promoter for the E. coli lac operon"
protein_bind complement(1054..1075)
/label=CAP binding site
/note="CAP binding activates transcription in the presence
of cAMP."
rep_origin complement(1363..1951)
/direction=LEFT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
CDS complement(2125..2982)
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMPTTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
promoter complement(2983..3087)
/label=AmpR promoter
primer_bind 3561..3577
/label=M13 fwd
/note="common sequencing primer, one of multiple similar
variants"
promoter 3580..3598
/label=SP6 promoter
/note="promoter for bacteriophage SP6 RNA polymerase"
This page is informational only.