Cart 2

P-element_XP vector (V009811#)

Basic Vector Information

Basic Vector Information
Vector Name P-element_XP Antibiotic Resistance Ampicillin
Length 10064 bp Type Cloning vector
Source Thibault ST, Singer MA, Miyazaki WY, Milash B, Dompe NA, Singh CM, Buchholz R, Demsky M, Fawcett R, Francis-Lang HL, Ryner L, Cheung LM, Chong A, Erickson C, Fisher WW, Greer K, Hartouni SR, Howie E,

P-element_XP vector Vector Map

FRT FRT white P element 3' end AmpR promoter Amp ori

P-element_XP vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported               10064 bp ds-DNA     circular SYN 18-DEC-2018
DEFINITION  Cloning vector P-element_XP, complete sequence.
ACCESSION   AY515149
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 10064)
  AUTHORS   Thibault ST, Singer MA, Miyazaki WY, Milash B, Dompe NA, Singh CM, 
            Buchholz R, Demsky M, Fawcett R, Francis-Lang HL, Ryner L, Cheung 
            LM, Chong A, Erickson C, Fisher WW, Greer K, Hartouni SR, Howie E, 
            Jakkula L, Joo D, Killpack K, Laufer A, Mazzotta J, Smith RD, 
            Stevens LM, Stuber C, Tan LR, Ventura R, Woo A, Zakrajsek I, Zhao L,
            Chen F, Swimmer C, Kopczynski C, Duyk G, Winberg ML, Margolis J.
  TITLE     A complementary transposon tool kit for Drosophila melanogaster 
            using P and piggyBac
  JOURNAL   Nat. Genet. 36 (3), 283-287 (2004)
  PUBMED    14981521
REFERENCE   2  (bases 1 to 10064)
  AUTHORS   Dompe NA, Buchholz R, Miyazaki WY, Kopczynski C.
  TITLE     Direct Submission
  JOURNAL   Submitted (19-DEC-2003) Exelixis, Inc., 170 Harbor Way, PO Box 511, 
            South San Francisco, CA 94083, USA
REFERENCE   3  (bases 1 to 10064)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..10064
                     /organism="Cloning vector P-element_XP"
                     /mol_type="other DNA"
                     /db_xref="taxon:261399"
     protein_bind    597..644
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     protein_bind    1390..1437
                     /label=FRT
                     /bound_moiety="FLP recombinase from the Saccharomyces 
                     cerevisiae 2u plasmid"
                     /note="FLP-mediated recombination occurs in the 8-bp core 
                     sequence TCTAGAAA (Turan and Bode, 2011)."
     CDS             complement(join(2400..3014,3085..3216,3437..3752,3814..4468,
                     4543..4816,5211..5282))
                     /codon_start=1
                     /gene="white"
                     /allele="+mC"
                     /product="white protein"
                     /label=white
                     /protein_id="AAS09823.1"
                     /translation="MGQEDQELLIRGGSKHPSAEHLNNGDSGAASQSCINQGFGQAKNY
                     GTLLPPSPPEDSGSGSGQLAENLTYAWHNMDIFGAVNQPGSGWRQLVNRTRGLFCNERH
                     IPAPRKHLLKNVCGVAYPGELLAVMGSSGAGKTTLLNALAFRSPQGIQVSPSGMRLLNG
                     QPVDAKEMQARCAYVQQDDLFIGSLTAREHLIFQAMVRMPRHLTYRQRVARVDQVIQEL
                     SLSKCQHTIIGVPGRVKGLSGGERKRLAFASEALTDPPLLICDEPTSGLDSFTAHSVVQ
                     VLKKLSQKGKTVILTIHQPSSELFELFDKILLMAEGRVAFLGTPSEAVDFFSYVGAQCP
                     TNYNPADFYVQVLAVVPGREIESRDRIAKICDNFAISKVARDMEQLLATKNLEKPLEQP
                     ENGYTYKATWFMQFRAVLWRSWLSVLKEPLLVKVRLIQTTMVAILIGLIFLGQQLTQVG
                     VMNINGAIFLFLTNMTFQNVFATINVFTSELPVFMREARSRLYRCDTYFLGKTIAELPL
                     FLTVPLVFTAIAYPMIGLRAGVLHFFNCLALVTLVANVSTSFGYLISCASSSTSMALSV
                     GPPVIIPFLLFGGFFLNSGSVPVYLKWLSYLSWFRYANEGLLINQWADVEPGEISCTSS
                     NTTCPSSGKVILETLNFSAADLPLDYVGLAILIVSFRVLAYLALRLRARRKE"
     gene            complement(2400..5282)
                     /gene="white"
                     /allele="+mC"
                     /label=white
     misc_feature    7072..7304
                     /label=P element 3' end
                     /note="P element 3' end"
     promoter        8106..8210
                     /gene="bla"
                     /label=AmpR promoter
     CDS             8211..9071
                     /codon_start=1
                     /gene="Amp"
                     /allele="+mC"
                     /product="beta-lactamase"
                     /function="ampicillin resistance"
                     /label=Amp
                     /protein_id="AAS09822.1"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     gene            8211..9071
                     /gene="Amp"
                     /allele="+mC"
                     /label=Amp
     rep_origin      9242..9830
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"

This page is informational only.