Basic Vector Information
- Vector Name:
- P-element_XP
- Antibiotic Resistance:
- Ampicillin
- Length:
- 10064 bp
- Type:
- Cloning vector
- Replication origin:
- ori
- Source/Author:
- Thibault ST, Singer MA, Miyazaki WY, Milash B, Dompe NA, Singh CM, Buchholz R, Demsky M, Fawcett R, Francis-Lang HL, Ryner L, Cheung LM, Chong A, Erickson C, Fisher WW, Greer K, Hartouni SR, Howie E,
P-element_XP vector Map
P-element_XP vector Sequence
LOCUS 40924_2328 10064 bp DNA circular SYN 18-DEC-2018
DEFINITION Cloning vector P-element_XP, complete sequence.
ACCESSION .
VERSION .
KEYWORDS .
SOURCE synthetic DNA construct
ORGANISM synthetic DNA construct
REFERENCE 1 (bases 1 to 10064)
AUTHORS Thibault ST, Singer MA, Miyazaki WY, Milash B, Dompe NA, Singh CM,
Buchholz R, Demsky M, Fawcett R, Francis-Lang HL, Ryner L, Cheung
LM, Chong A, Erickson C, Fisher WW, Greer K, Hartouni SR, Howie E,
Jakkula L, Joo D, Killpack K, Laufer A, Mazzotta J, Smith RD,
Stevens LM, Stuber C, Tan LR, Ventura R, Woo A, Zakrajsek I, Zhao L,
Chen F, Swimmer C, Kopczynski C, Duyk G, Winberg ML, Margolis J.
TITLE A complementary transposon tool kit for Drosophila melanogaster
using P and piggyBac
JOURNAL Nat. Genet. 36 (3), 283-287 (2004)
PUBMED 14981521
REFERENCE 2 (bases 1 to 10064)
AUTHORS Dompe NA, Buchholz R, Miyazaki WY, Kopczynski C.
TITLE Direct Submission
JOURNAL Submitted (19-DEC-2003) Exelixis, Inc., 170 Harbor Way, PO Box 511,
South San Francisco, CA 94083, USA
REFERENCE 3 (bases 1 to 10064)
TITLE Direct Submission
REFERENCE 4 (bases 1 to 10064)
AUTHORS .
TITLE Direct Submission
COMMENT SGRef: number: 1; type: "Journal Article"; journalName: "Nat.
Genet."; date: "2004"; volume: "36"; issue: "3"; pages: "283-287"
COMMENT SGRef: number: 2; type: "Journal Article"; journalName: "Submitted
(19-DEC-2003) Exelixis, Inc., 170 Harbor Way, PO Box 511, South San
Francisco, CA 94083, USA"
COMMENT SGRef: number: 3; type: "Journal Article"
FEATURES Location/Qualifiers
source 1..10064
/mol_type="other DNA"
/organism="synthetic DNA construct"
protein_bind 597..644
/label=FRT
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
protein_bind 1390..1437
/label=FRT
/bound_moiety="FLP recombinase from the Saccharomyces
cerevisiae 2u plasmid"
/note="FLP-mediated recombination occurs in the 8-bp core
sequence TCTAGAAA (Turan and Bode, 2011)."
gene complement(1633..5769)
/label=mini-white
/note="This modified version of the white gene lacks part
of the first intron."
misc_feature 7072..7304
/label=P element 3' end
/note="P element 3' end"
promoter 8106..8210
/label=AmpR promoter
CDS 8211..9068
/codon_start=1
/label=AmpR
/note="beta-lactamase"
/translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
LIKHW"
rep_origin 9242..9830
/direction=RIGHT
/label=ori
/note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
replication"
This page is informational only.