Cart 2

mini-CTX-lacZ vector (V009850#)

Basic Vector Information

Basic Vector Information
Vector Name mini-CTX-lacZ Antibiotic Resistance Tetracycline
Length 8875 bp Type Integration vector
Source Hoang TT, Kutchma AJ, Becher A, Schweizer HP.

mini-CTX-lacZ vector Vector Map

Flp recombinase binding site phage CTX attachment site, core sequence T4 transcription termination signal T3 promoter lacZ RNAse III processing site multiple cloning site T7 promoter T4 transcription termination signal Flp recombinase binding site int ori tet

mini-CTX-lacZ vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                8875 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Integration vector mini-CTX-lacZ, complete sequence.
ACCESSION   AF140579
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8875)
  AUTHORS   Hoang TT, Kutchma AJ, Becher A, Schweizer HP.
  TITLE     A site-specific gene integration system for Pseudomonas aeruginosa
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 8875)
  AUTHORS   Hoang TT, Kutchma AJ, Becher A, Schweizer HP.
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-1999) Microbiology, Colorado State University, 
            Fort Collins, CO 80523, USA
REFERENCE   3  (bases 1 to 8875)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..8875
                     /organism="Integration vector mini-CTX-lacZ"
                     /lab_host="Pseudomonas aeruginosa"
                     /mol_type="other DNA"
                     /db_xref="taxon:106409"
     protein_bind    238..285
                     /label=Flp recombinase binding site
                     /bound_moiety="Flp recombinase"
                     /note="Flp recombinase target site"
     misc_feature    495..521
                     /label=phage CTX attachment site, core sequence
                     /note="phage CTX attachment site, core sequence"
     regulatory      745..769
                     /regulatory_class="terminator"
                     /note="T4 transcription termination signal"
     regulatory      827..846
                     /regulatory_class="promoter"
                     /note="T3 promoter"
     promoter        827..845
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     CDS             complement(921..3995)
                     /codon_start=1
                     /gene="lacZ"
                     /product="beta-galactosidase"
                     /label=lacZ
                     /protein_id="AAF06120.1"
                     /translation="MTMITDSLAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEART
                     DRPSQQLRSLNGEWRFAWFPAPEAVPESWLECDLPEADTVVVPSNWQMHGYDAPIYTNV
                     TYPITVNPPFVPTENPTGCYSLTFNVDESWLQEGQTRIIFDGVNSAFHLWCNGRWVGYG
                     QDSRLPSEFDLSAFLRAGENRLAVMVLRWSDGSYLEDQDMWRMSGIFRDVSLLHKPTTQ
                     ISDFHVATRFNDDFSRAVLEAEVQMCGELRDYLRVTVSLWQGETQVASGTAPFGGEIID
                     ERGGYADRVTLRLNVENPKLWSAEIPNLYRAVVELHTADGTLIEAEACDVGFREVRIEN
                     GLLLLNGKPLLIRGVNRHEHHPLHGQVMDEQTMVQDILLMKQNNFNAVRCSHYPNHPLW
                     YTLCDRYGLYVVDEANIETHGMVPMNRLTDDPRWLPAMSERVTRMVQRDRNHPSVIIWS
                     LGNESGHGANHDALYRWIKSVDPSRPVQYEGGGADTTATDIICPMYARVDEDQPFPAVP
                     KWSIKKWLSLPGETRPLILCEYAHAMGNSLGGFAKYWQAFRQYPRLQGGFVWDWVDQSL
                     IKYDENGNPWSAYGGDFGDTPNDRQFCMNGLVFADRTPHPALTEAKHQQQFFQFRLSGQ
                     TIEVTSEYLFRHSDNELLHWMVALDGKPLASGEVPLDVAPQGKQLIELPELPQPESAGQ
                     LWLTVRVVQPNATAWSEAGHISAWQQWRLAENLSVTLPAASHAIPHLTTSEMDFCIELG
                     NKRWQFNRQSGFLSQMWIGDKKQLLTPLRDQFTRAPLDNDIGVSEATRIDPNAWVERWK
                     AAGHYQAEAALLQCTADTLADAVLITTAHAWQHQGKTLFISRKTYRIDGSGQMAITVDV
                     EVASDTPHPARIGLNCQLAQVAERVNWLGLGPQENYPDRLTAACFDRWDLPLSDMYTPY
                     VFPSENGLRCGTRELNYGPHQWRGDFQFNISRYSQQQLMETSHRHLLHAEEGTWLNIDG
                     FHMGIGGDDSWSPSVSAEFQLSAGRYHYQLVWCQK"
     gene            complement(921..3995)
                     /gene="lacZ"
                     /label=lacZ
     misc_feature    972..977
                     /note="location of uncharacterized mutation which removes 
                     EcoRI site"
     primer_bind     3959..3975
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     primer_bind     complement(3991..4007)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     misc_feature    4059..4135
                     /label=RNAse III processing site
                     /note="RNAse III processing site"
     misc_feature    4159..4230
                     /label=multiple cloning site
                     /note="multiple cloning site"
     primer_bind     complement(4197..4213)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      4238..4257
                     /regulatory_class="promoter"
                     /note="T7 promoter"
     promoter        complement(4239..4257)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     regulatory      4316..4340
                     /regulatory_class="terminator"
                     /note="T4 transcription termination signal"
     protein_bind    4431..4478
                     /label=Flp recombinase binding site
                     /bound_moiety="Flp recombinase"
                     /note="Flp recombinase target site"
     oriT            4678..4937
     oriT            4685..4793
                     /note="incP origin of transfer"
     CDS             complement(4952..6121)
                     /codon_start=1
                     /gene="int"
                     /product="integrase"
                     /label=int
                     /protein_id="AAF06121.1"
                     /translation="MADGVEVRGKRIRIYFRYQGELCRESIPGDATPENIANAERLAGI
                     INYEIKQGVFSYSRHFPDSPRVKSNTLGHYIDLWLDIKRNQIAASGFRGYTSRVETHIR
                     PRWGDSQADSIDHLDIQDWVQNTLMPKLHNKTVREIVSNLRQIFRLYRTRNRSAHDPTD
                     GIVITLPDADDPDPFTREEIDLILGTETARIGELNLAEFMIWSGPRVSEAIALAWEDVD
                     LDTGTVVFRRARVRSQYKVTKTRRSTRKVQLLAPALRALQQQAKLTRRLPPVQIEVIDR
                     DNRTRKPQRVRFVFHNSASGAAYSTSDTLRNGWWHGHLRNAGVRSRGPNQCRHTFASQM
                     LSSGIATPEWIADQMGHTSTAMIFKHYAKWISKDGPDIVGLLNQALKLS"
     gene            complement(4952..6121)
                     /gene="int"
                     /label=int
                     /note="modified phage CTX integrase gene"
     rep_origin      complement(6218..6806)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(7628..8818)
                     /codon_start=1
                     /gene="tet"
                     /product="Tet protein"
                     /label=tet
                     /protein_id="AAF06122.1"
                     /translation="MKSNNALIVILGTVTLDAVGIGLVMPVLPGLLRDIVHSDSIASHY
                     GVLLALYALMQFLCAPVLGALSDRFGRRPVLLASLLGATIDYAIMATTPVLWILYAGRI
                     VAGITGATGAVAGAYIADITDGEDRARHFGLMSACFGVGMVAGPVAGGLLGAISLHAPF
                     LAAAVLNGLNLLLGCFLMQESHKGERRPMPLRAFNPVSSFRWARGMTIVAALMTVFFIM
                     QLVGQVPAALWVIFGEDRFRWSATMIGLSLAVFGILHALAQAFVTGPATKRFGEKQAII
                     AGMAADALGYVLLAFATRGWMAFPIMILLASGGIGMPALQAMLSRQVDDDHQGQLQGSL
                     AALTSLTSITGPLIVTAIYAASASTWNGLAWIVGAALYLVCLPALRRGAWSRATST"
     gene            complement(7628..8818)
                     /gene="tet"
                     /label=tet
                     /note="modified tet gene"
     promoter        complement(8866..19)
                     /label=tet promoter
                     /note="E. coli promoter for tetracycline efflux protein 
                     gene"

This page is informational only.