Cart 2

mceG vector (V009852#)

Basic Vector Information

Basic Vector Information
Vector Name mceG Length 5871 bp
Type Expression vector Source Joshi SM, Pandey AK, Capite N, Fortune SM, Rubin EJ, Sassetti CM.

mceG vector Vector Map

promoter from Mycobacterium tuberculosis groEL2 gene mceG-his_myc apra replication origin from pUC mycobacterial origin of replication from pAL5000

mceG vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                5871 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Expression vector mceG, complete sequence.
ACCESSION   DQ823234
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5871)
  AUTHORS   Joshi SM, Pandey AK, Capite N, Fortune SM, Rubin EJ, Sassetti CM.
  TITLE     Characterization of mycobacterial virulence genes through genetic 
            interaction mapping
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 103 (31), 11760-11765 (2006)
  PUBMED    16868085
REFERENCE   2  (bases 1 to 5871)
  AUTHORS   Joshi SM, Pandey AK, Capite NM, Fortune SM, Rubin EJ, Sassetti CM.
  TITLE     Direct Submission
  JOURNAL   Submitted (26-JUN-2006) Molecular Genetics and Microbiology, 
            University of Massachusetts Medical School, 55 Lake Ave. North, 
            Worcester, MA 01655, USA
REFERENCE   3  (bases 1 to 5871)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..5871
                     /organism="Expression vector mceG"
                     /mol_type="other DNA"
                     /db_xref="taxon:393138"
     regulatory      7..394
                     /regulatory_class="promoter"
                     /note="promoter from Mycobacterium tuberculosis groEL2 
                     gene"
     CDS             443..1576
                     /codon_start=1
                     /gene="mceG-his_myc"
                     /product="mceG-6xHIS-myc"
                     /label=mceG-his_myc
                     /note="epitope tagged MceG"
                     /protein_id="ABG72763.1"
                     /translation="MRYSDSYHTTGRWQPRASTEGFPMGVSIEVNGLTKSFGSSRIWED
                     VTLTIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSIIIDGTDIIECSAKELYEIRT
                     LFGVLFQDGALFGSMNLYDNTAFPLREHTKKKESEIRDIVMEKLALVGLGGDEKKFPGE
                     ISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINAQIDATILIVTH
                     NINIARTVPDNMGMLFRKHLVMFGPREVLLTSDEPVVRQFLNGRRIGPIGMSEEKDEAT
                     MAEEQALLDAGHHAGGVEEIEGVPPQISATPGMPERKAVARRQARVREMLHTLPKKAQA
                     AILDDLEGTHKYAVHEIGQHHHHHHMAEQKLISEEDL"
     gene            443..1576
                     /gene="mceG-his_myc"
                     /label=mceG-his_myc
     regulatory      1280..1289
                     /regulatory_class="other"
                     /note="vertebrate consensus sequence for strong initiation 
                     of translation (Kozak, 1987)"
     CDS             1520..1537
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     CDS             1544..1573
                     /codon_start=1
                     /product="Myc (human c-Myc proto-oncogene) epitope tag"
                     /label=Myc
                     /translation="EQKLISEEDL"
     CDS             1931..2743
                     /codon_start=1
                     /gene="apra"
                     /product="aminoglycoside-(3)-acetyltransferase IV"
                     /label=apra
                     /note="apramycin resistance"
                     /protein_id="ABG72764.1"
                     /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP
                     LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV
                     KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH
                     LAELMAKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH
                     AFARLIRSRDIVATALGQLGRDPLIFLHPPEGGMRRMRCRSPVDWLSS"
     gene            1931..2743
                     /gene="apra"
                     /label=apra
     rep_origin      3182..3946
                     /label=replication origin from pUC
                     /note="replication origin from pUC"
     rep_origin      3204..3792
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     rep_origin      3951..5845
                     /label=mycobacterial origin of replication from pAL5000
                     /note="mycobacterial origin of replication from pAL5000"

This page is informational only.