NovoPro
Cart 2

LUCTRAP-2 vector

Basic Vector Information

Basic Vector Information
Vector Name LUCTRAP-2 Length 6145 bp
Type Cloning vector Source Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, Schwechheimer C.

LUCTRAP-2 vector Vector Map

LUCTRAP-2 vector Sequence

Copy Sequence

Download SnapGene Map(.dna)

Download GeneBank File(.gb)

LOCUS       Exported                6145 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector LUCTRAP-2, complete sequence.
ACCESSION   AY944582
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6145)
  AUTHORS   Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, 
            Schwechheimer C.
  TITLE     LucTrap vectors are tools to generate luciferase fusions for the 
            quantification of transcript and protein abundance in vivo
  JOURNAL   Plant Physiol. 141 (1), 3-14 (2006)
  PUBMED    16684932
REFERENCE   2  (bases 1 to 6145)
  AUTHORS   Calderon LIA. V, Kuhnle C, Dohmann EMN., Li H, Schwechheimer C.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-2005) Developmental Genetics, Centre for Plant 
            Molecular Biology, Auf der Morgenstelle 5, Tuebingen 72076, Germany
REFERENCE   3  (bases 1 to 6145)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Dec 18, 2018 from SnapGene 4.1.8
            http://www.snapgene.com
FEATURES             Location/Qualifiers
     source          1..6145
                     /organism="Cloning vector LUCTRAP-2"
                     /mol_type="other DNA"
                     /db_xref="taxon:326400"
     CDS             320..1135
                     /codon_start=1
                     /product="NPT1"
                     /label=NPT1
                     /note="derived from Escherichia coli"
                     /protein_id="AAY29063.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYGLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      1236..1824
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    1915..1939
                     /label=T-DNA right border
                     /note="T-DNA right border"
     intron          2014..2102
                     /note="intron Galpha subunit 1 derived from Arabidopsis 
                     thaliana"
     misc_feature    2125..3777
                     /note="modified firefly luciferase; lacks start codon to 
                     prevent random transcription/translation"
     CDS             2128..3777
                     /codon_start=1
                     /gene="luc+"
                     /product="firefly luciferase"
                     /label=luciferase
                     /note="enhanced luc+ version of the luciferase gene"
                     /translation="EDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAH
                     IEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPA
                     NDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSM
                     YTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHAR
                     DPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKI
                     QSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYG
                     LTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSG
                     YVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILL
                     QHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVF
                     VDEVPKGLTGKLDARKIREILIKAKKGGKIAV"
     regulatory      3793..3912
                     /regulatory_class="terminator"
                     /note="35S CaMV terminator"
     primer_bind     complement(3932..3948)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(3974..3992)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(3999..4015)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      4190..4462
                     /regulatory_class="promoter"
                     /note="NOS promoter"
     promoter        4262..4441
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     CDS             4475..5269
                     /codon_start=1
                     /product="APH(3')-IIA"
                     /label=APH
                     /note="resistance protein"
                     /protein_id="AAY29064.1"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERGRTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKARMPDGEDLVVTQGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     regulatory      5306..5565
                     /regulatory_class="terminator"
                     /note="NOS terminator"
     terminator      5309..5560
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    5582..5606
                     /label=T-DNA left border
                     /note="T-DNA left border"
     misc_feature    5584..5606
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA 
                     (truncated)"
     rep_origin      5622..30
     rep_origin      5739..29
                     /label=pSa ori
                     /note="origin of replication from bacterial plasmid pSa"

This page is informational only.