LUCTRAP-1 vector (V009856)

Basic Vector Information

      • Vector Name:
      • LUCTRAP-1
      • Length:
      • 6149 bp
      • Type:
      • Cloning vector
      • Source/Author:
      • Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, Schwechheimer C.

LUCTRAP-1 vector Vector Map

LUCTRAP-16149 bp30060090012001500180021002400270030003300360039004200450048005100540057006000NPT1oriT-DNA right borderintron Galpha subunit 1 derived from Arabidopsis thalianaLUC+35S CaMV terminatorKS primerT7 promoterM13 fwdNOS promoterAPHNOS terminatorT-DNA left border

Plasmid Resuspension Protocol:

1. Centrifuge at 5,000×g for 5 min.

2. Carefully open the tube and add 20 μl of sterile water to dissolve the DNA.

3. Close the tube and incubate for 10 minutes at room temperature.

4. Briefly vortex the tube and then do a quick spin to concentrate the liquid at the bottom. Speed is less than 5000×g.

5.Store the plasmid at -20 ℃.

LUCTRAP-1 vector Sequence

Copy Sequence

Download GeneBank File(.gb)

LOCUS       Exported                6149 bp ds-DNA     circular SYN 17-DEC-2018
DEFINITION  Cloning vector LUCTRAP-1, complete sequence.
ACCESSION   AY944581
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6149)
  AUTHORS   Calderon-Villalobos LI, Kuhnle C, Li H, Rosso M, Weisshaar B, 
            Schwechheimer C.
  TITLE     LucTrap vectors are tools to generate luciferase fusions for the 
            quantification of transcript and protein abundance in vivo
  JOURNAL   Plant Physiol. 141 (1), 3-14 (2006)
  PUBMED    16684932
REFERENCE   2  (bases 1 to 6149)
  AUTHORS   Calderon LIA. V, Kuhnle C, Dohmann EMN., Li H, Schwechheimer C.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-FEB-2005) Developmental Genetics, Centre for Plant 
            Molecular Biology, Auf der Morgenstelle 5, Tuebingen 72076, Germany
REFERENCE   3  (bases 1 to 6149)
  AUTHORS   .
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6149
                     /organism="Cloning vector LUCTRAP-1"
                     /mol_type="other DNA"
                     /db_xref="taxon:326399"
     CDS             320..1135
                     /codon_start=1
                     /gene="NPT1"
                     /product="NPT1"
                     /label=NPT1
                     /note="derived from Escherichia coli"
                     /protein_id="AAY29060.1"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYGLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     gene            320..1135
                     /gene="NPT1"
                     /label=NPT1
     rep_origin      1236..1824
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    1915..1939
                     /label=T-DNA right border
                     /note="T-DNA right border"
     intron          2014..2102
                     /note="intron Galpha subunit 1 derived from Arabidopsis 
                     thaliana"
     CDS             2129..3781
                     /codon_start=1
                     /product="LUC+"
                     /label=LUC+
                     /note="modified firefly luciferase"
                     /protein_id="AAY29061.1"
                     /translation="MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDA
                     HIEVDITYAEYFEMSVRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAP
                     ANDIYNERELLNSMGISQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQS
                     MYTFVTSHLPPGFNEYDFVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHA
                     RDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYK
                     IQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGY
                     GLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMS
                     GYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESIL
                     LQHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVV
                     FVDEVPKGLTGKLDARKIREILIKAKKGGKIAV"
     regulatory      3797..3916
                     /regulatory_class="terminator"
                     /note="35S CaMV terminator"
     primer_bind     complement(3936..3952)
                     /label=KS primer
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     promoter        complement(3978..3996)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(4003..4019)
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     regulatory      4194..4466
                     /regulatory_class="promoter"
                     /note="NOS promoter"
     promoter        4266..4445
                     /label=NOS promoter
                     /note="nopaline synthase promoter"
     CDS             4479..5273
                     /codon_start=1
                     /product="APH(3')-IIA"
                     /label=APH
                     /note="resistance protein"
                     /protein_id="AAY29062.1"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERGRTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKARMPDGEDLVVTQGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     regulatory      5310..5569
                     /regulatory_class="terminator"
                     /note="NOS terminator"
     terminator      5313..5564
                     /label=NOS terminator
                     /note="nopaline synthase terminator and poly(A) signal"
     misc_feature    5586..5610
                     /label=T-DNA left border
                     /note="T-DNA left border"
     misc_feature    5588..5610
                     /label=LB T-DNA repeat
                     /note="left border repeat from nopaline C58 T-DNA 
                     (truncated)"
     rep_origin      5632..30
     rep_origin      5743..29
                     /label=pSa ori
                     /note="origin of replication from bacterial plasmid pSa"

This page is informational only.