L149 vector (V009886)

Download GeneBank File(.gb)

LOCUS       40924_1529        9502 bp DNA     circular SYN 17-DEC-2018
DEFINITION  Retroviral expression vector L149, complete sequence.
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 9502)
  AUTHORS   Micklem DR, Lorens JB.
  TITLE     Direct Submission
  JOURNAL   Submitted (27-MAY-2008) Department of Biomedicine, University of 
            Bergen, Jonas Lies vei 91, Bergen 5009, Norway
REFERENCE   2  (bases 1 to 9502)
  TITLE     Direct Submission
REFERENCE   3  (bases 1 to 9502)
  AUTHORS   .
  TITLE     Direct Submission
COMMENT     SGRef: number: 1; type: "Journal Article"; journalName: "Submitted 
            (27-MAY-2008) Department of Biomedicine, University of Bergen, Jonas
            Lies vei 91, Bergen 5009, Norway"
COMMENT     SGRef: number: 2; type: "Journal Article"
FEATURES             Location/Qualifiers
     source          1..9502
                     /mol_type="other DNA"
                     /organism="synthetic DNA construct"
     enhancer        62..365
                     /label=CMV enhancer
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        366..569
                     /label=CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     misc_feature    601..609
                     /label=R region 5'LTR
                     /note="R region 5'LTR"
     misc_feature    670..745
                     /label=U5 region 5'LTR
                     /note="U5 region 5'LTR"
     misc_feature    808..1165
                     /label=MMLV Psi
                     /note="packaging signal of Moloney murine leukemia virus
                     (MMLV)"
     CDS             1230..1646
                     /label=gag (truncated)
                     /note="truncated Moloney murine leukemia virus (MMLV) gag
                     gene lacking the start codon"
     misc_feature    1656..2030
                     /label=pol region
                     /note="Moloney murine leukemia virus (MMLV) pol region 
                     containing the splice acceptor site"
     polyA_signal    complement(2049..2256)
                     /label=bGH poly(A) signal
                     /note="bovine growth hormone polyadenylation signal"
     misc_feature    complement(2946..3029)
                     /gene="P2AG2ALuc2ANTR"
                     /label=FMDV 2A self-cleaving linker region
                     /note="FMDV 2A self-cleaving linker region"
     CDS             complement(3030..4679)
                     /label=luciferase
                     /note="firefly luciferase"
     misc_feature    complement(4680..4763)
                     /gene="P2AG2ALuc2ANTR"
                     /label=FMDV 2A self-cleaving linker region
                     /note="FMDV 2A self-cleaving linker region"
     CDS             complement(4764..5480)
                     /label=EGFP
                     /note="enhanced GFP"
     misc_feature    5481..5549
                     /label=FMDV 2A self-cleaving linker region
                     /note="FMDV 2A self-cleaving linker region"
     CDS             complement(5553..6146)
                     /codon_start=1
                     /gene="pac from Streptomyces alboniger"
                     /product="puromycin N-acetyltransferase"
                     /label=PuroR
                     /note="confers resistance to puromycin"
                     /translation="MTEYKPTVRLATRDDVPRAVRTLAAAFADYPATRHTVDPDRHIER
                     VTELQELFLTRVGLDIGKVWVADDGAAVAVWTTPESVEAGAVFAEIGPRMAELSGSRLA
                     AQQQMEGLLAPHRPKEPAWFLATVGVSPDHQGKGLGSAVVLPGVEAAERAGVPAFLETS
                     APRNLPFYERLGFTVTADVEVPEGPRTWCMTRKPG"
     intron          complement(6230..6362)
                     /label=chimeric intron
                     /note="chimera between introns from human beta-globin and 
                     immunoglobulin heavy chain genes"
     regulatory      complement(6465..6517)
                     /label=PhCMV* minimal promoter
                     /note="PhCMV* minimal promoter"
                     /regulatory_class="promoter"
     promoter        complement(6480..6517)
                     /label=minimal CMV promoter
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     protein_bind    complement(6550..6820)
                     /label=tetracycline response element
                     /note="contains seven copies of the tetracycline operator
                     tetO"
     misc_feature    6892..7056
                     /label=U3SIN (self-inactivating) region
                     /note="U3SIN (self-inactivating) region"
     repeat_region   6892..7056
                     /label=MoMLV 3'LTR, self-inactivating
                     /note="MoMLV 3'LTR, self-inactivating"
     misc_feature    7058..7125
                     /label=R region 3'LTR
                     /note="R region 3'LTR"
     primer_bind     complement(7278..7294)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    complement(7302..7318)
                     /label=lac operator
                     /note="The lac repressor binds to the lac operator to
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(7326..7356)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    complement(7371..7392)
                     /label=CAP binding site
                     /note="CAP binding activates transcription in the presence
                     of cAMP."
     rep_origin      complement(7680..8268)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(8445..9302)
                     /label=AmpR
                     /note="beta-lactamase"
     promoter        complement(9303..9407)
                     /label=AmpR promoter